BLASTX nr result
ID: Zingiber24_contig00033229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033229 (296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518455.1| PREDICTED: UPF0481 protein At3g47200-like [G... 55 1e-05 >ref|XP_003518455.1| PREDICTED: UPF0481 protein At3g47200-like [Glycine max] Length = 459 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 NPWAVISVVAAILLFVLTIVQTVYSVLCYHQPP 101 NPWA++S+VAAI LF LTIVQTVY++ Y+QPP Sbjct: 406 NPWAIVSLVAAIFLFALTIVQTVYTIAQYYQPP 438