BLASTX nr result
ID: Zingiber24_contig00033164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00033164 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD85300.1| embryonic flower 2 [Yucca filamentosa] 58 1e-06 gb|ABD85301.1| polycomb group protein EMF2 [Asparagus officinalis] 58 1e-06 gb|AEJ87969.1| EMF protein [Phyllostachys edulis] 57 3e-06 gb|ABB77210.1| EMF2 [Dendrocalamus latiflorus] 57 3e-06 >gb|ABD85300.1| embryonic flower 2 [Yucca filamentosa] Length = 699 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 KLWNHSLLDARTMNNCSLILERFQNESSGPKQ 98 KLWNHSLLDARTMNNC++ILER+QN PKQ Sbjct: 667 KLWNHSLLDARTMNNCNIILERYQNGIPDPKQ 698 >gb|ABD85301.1| polycomb group protein EMF2 [Asparagus officinalis] Length = 708 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 KLWNHSLLDARTMNNCSLILERFQNESSGPKQ 98 KLWNHSLLDAR MNNC++IL R+QNE S PKQ Sbjct: 674 KLWNHSLLDARAMNNCNIILGRYQNEISDPKQ 705 >gb|AEJ87969.1| EMF protein [Phyllostachys edulis] Length = 606 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 KLWNHSLLDARTMNNCSLILERFQNESSGPKQ 98 KLWNHSLLDARTMN C++IL+ F+NESS PK+ Sbjct: 574 KLWNHSLLDARTMNTCNIILDGFKNESSDPKK 605 >gb|ABB77210.1| EMF2 [Dendrocalamus latiflorus] Length = 629 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 KLWNHSLLDARTMNNCSLILERFQNESSGPKQ 98 KLWNHSLLDARTMN C+ ILE +QNES PKQ Sbjct: 597 KLWNHSLLDARTMNTCNTILEGYQNESPDPKQ 628