BLASTX nr result
ID: Zingiber24_contig00032969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00032969 (878 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579139.1| PREDICTED: protein kinase PINOID-like [Brach... 57 9e-06 >ref|XP_003579139.1| PREDICTED: protein kinase PINOID-like [Brachypodium distachyon] Length = 517 Score = 57.0 bits (136), Expect = 9e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 126 SPSALAQLPSKPHRSSDPAWAAIRCRSFPANLCPRDFKLLRR 1 SPSA P++PHRSSDPAWAAIR S + L P DFKL+RR Sbjct: 128 SPSASLASPARPHRSSDPAWAAIRAASLKSPLGPADFKLVRR 169