BLASTX nr result
ID: Zingiber24_contig00032078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00032078 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHJ57305.1| chloroplast monoterpene synthase [Hedychium coron... 63 5e-08 >gb|AHJ57305.1| chloroplast monoterpene synthase [Hedychium coronarium] Length = 593 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -3 Query: 222 SPLEEYFMNIQVNIPRTAQFFYDHEGDGYGKAYGETKSQIILLLFEPIQ 76 S EEYF N+ +N+PR AQFFY +GDGY A GET+ Q++ LL EP+Q Sbjct: 546 SSFEEYFQNVAINLPRAAQFFYG-KGDGYANADGETQKQVMSLLIEPVQ 593