BLASTX nr result
ID: Zingiber24_contig00032062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00032062 (644 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ04888.1| hypothetical protein PRUPE_ppa026107mg, partial [... 58 3e-06 ref|XP_004289104.1| PREDICTED: probable dimethyladenosine transf... 57 4e-06 gb|EOX90955.1| Ribosomal RNA adenine dimethylase family protein ... 56 8e-06 >gb|EMJ04888.1| hypothetical protein PRUPE_ppa026107mg, partial [Prunus persica] Length = 344 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 2 KEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 121 KEK+ G+LKS +E KRPSKLSN + LHLL LFNQ GI F Sbjct: 286 KEKLMGVLKSADFEDKRPSKLSNEELLHLLALFNQAGIYF 325 >ref|XP_004289104.1| PREDICTED: probable dimethyladenosine transferase-like [Fragaria vesca subsp. vesca] Length = 375 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 2 KEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 121 KEK+ G+LKS +E KRPSKLSN + LHLL LFNQ GI F Sbjct: 321 KEKLIGVLKSADFENKRPSKLSNDELLHLLALFNQAGIYF 360 >gb|EOX90955.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao] Length = 389 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 2 KEKINGILKSVGYEGKRPSKLSNADFLHLLQLFNQEGILF 121 KEKI GIL++ G+E KRPSKLSN + LHLL LFNQ GI F Sbjct: 330 KEKIVGILRTGGFEDKRPSKLSNEELLHLLFLFNQAGIHF 369