BLASTX nr result
ID: Zingiber24_contig00031534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00031534 (512 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC26767.1| hypothetical protein L484_023383 [Morus notabilis] 92 9e-17 gb|AFU36090.1| calcineurin B-like protein 1 [Lilium longiflorum] 91 1e-16 ref|NP_001239047.1| calcineurin B-like 1 [Solanum lycopersicum] ... 91 2e-16 ref|XP_003559049.1| PREDICTED: calcineurin B-like protein 1-like... 90 3e-16 gb|AFW87839.1| hypothetical protein ZEAMMB73_561226 [Zea mays] 90 4e-16 gb|ACR33988.1| unknown [Zea mays] 90 4e-16 ref|XP_002467472.1| hypothetical protein SORBIDRAFT_01g028750 [S... 90 4e-16 tpg|DAA46342.1| TPA: hypothetical protein ZEAMMB73_542379 [Zea m... 90 4e-16 ref|NP_001151319.1| calcineurin B-like protein 9 [Zea mays] gi|1... 90 4e-16 ref|NP_001130480.1| uncharacterized protein LOC100191578 [Zea ma... 90 4e-16 gb|AGO81718.1| calcineurin B-like protein 1 [Saccharum hybrid cu... 89 5e-16 gb|AFR90208.1| calcineurin B-like protein 1 [Triticum aestivum] ... 89 6e-16 ref|XP_004164617.1| PREDICTED: calcineurin B-like protein 1-like... 89 6e-16 ref|XP_004147242.1| PREDICTED: calcineurin B-like protein 1-like... 89 6e-16 ref|NP_001267901.1| calcineurin B-like protein 01 [Vitis vinifer... 89 6e-16 ref|XP_006662075.1| PREDICTED: calcineurin B-like protein 1-like... 89 8e-16 ref|XP_006284521.1| hypothetical protein CARUB_v10005722mg [Caps... 89 8e-16 ref|XP_006281094.1| hypothetical protein CARUB_v10027124mg [Caps... 89 8e-16 gb|ABA54176.1| calcineurin B-like protein 1 [Oryza sativa Japoni... 89 8e-16 ref|NP_974566.1| calcineurin B-like protein 1 [Arabidopsis thali... 89 8e-16 >gb|EXC26767.1| hypothetical protein L484_023383 [Morus notabilis] Length = 278 Score = 91.7 bits (226), Expect = 9e-17 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDKTEW+ FVS NPSL+KIMTLPYLRDITTTFPSFVF SEV++IAT Sbjct: 229 QDGKIDKTEWQNFVSKNPSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT 278 >gb|AFU36090.1| calcineurin B-like protein 1 [Lilium longiflorum] Length = 213 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDKTEWE FVS NPSL+KIMTL YLRDITTTFPSFVF SEV+DIAT Sbjct: 164 QDGKIDKTEWENFVSRNPSLLKIMTLSYLRDITTTFPSFVFNSEVDDIAT 213 >ref|NP_001239047.1| calcineurin B-like 1 [Solanum lycopersicum] gi|353523402|dbj|BAL04561.1| calcineurin B-like molecule [Solanum lycopersicum] Length = 213 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDK+EW+ FVS NPSL+KIMTLPYLRDITTTFPSFVF+SEV+++AT Sbjct: 164 QDGKIDKSEWQIFVSQNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEVAT 213 >ref|XP_003559049.1| PREDICTED: calcineurin B-like protein 1-like [Brachypodium distachyon] Length = 212 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+ EWE FVS NPSL+KIMTLPYL+DITTTFPSFVF+SEV+DI T Sbjct: 163 QDGKIDRAEWENFVSRNPSLLKIMTLPYLKDITTTFPSFVFHSEVDDIVT 212 >gb|AFW87839.1| hypothetical protein ZEAMMB73_561226 [Zea mays] Length = 143 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 94 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 143 >gb|ACR33988.1| unknown [Zea mays] Length = 96 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 47 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 96 >ref|XP_002467472.1| hypothetical protein SORBIDRAFT_01g028750 [Sorghum bicolor] gi|229609863|gb|ACQ83547.1| calcineurin B-like protein 01 [Sorghum bicolor] gi|241921326|gb|EER94470.1| hypothetical protein SORBIDRAFT_01g028750 [Sorghum bicolor] gi|516282890|gb|AGO81722.1| calcineurin B-like protein 9 [Saccharum hybrid cultivar GT28] Length = 213 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >tpg|DAA46342.1| TPA: hypothetical protein ZEAMMB73_542379 [Zea mays] Length = 109 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 60 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 109 >ref|NP_001151319.1| calcineurin B-like protein 9 [Zea mays] gi|195621630|gb|ACG32645.1| calcineurin B-like protein 9 [Zea mays] gi|195645804|gb|ACG42370.1| calcineurin B-like protein 9 [Zea mays] gi|413955194|gb|AFW87843.1| calcineurin B-like protein 9 [Zea mays] Length = 213 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >ref|NP_001130480.1| uncharacterized protein LOC100191578 [Zea mays] gi|194689246|gb|ACF78707.1| unknown [Zea mays] gi|215398101|gb|ACJ65315.1| calcineurin B-like protein [Zea mays] gi|414867784|tpg|DAA46341.1| TPA: calcineurin B-like protein [Zea mays] Length = 213 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMKIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGKIDRTEWENFVTRNPSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >gb|AGO81718.1| calcineurin B-like protein 1 [Saccharum hybrid cultivar GT28] Length = 213 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FV+ NPSLMK+MTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGKIDRTEWENFVTRNPSLMKVMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >gb|AFR90208.1| calcineurin B-like protein 1 [Triticum aestivum] gi|473782044|gb|EMS46117.1| Calcineurin B-like protein 1 [Triticum urartu] Length = 215 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKID+TEWE FVS NPSL+KIMTL YL+DITTTFPSFVF+SEV+DI T Sbjct: 166 QDGKIDRTEWENFVSRNPSLLKIMTLSYLKDITTTFPSFVFHSEVDDIVT 215 >ref|XP_004164617.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] Length = 213 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDK EW+ FVS NPSL+K+MTLPYLRDITTTFPSFVF SEV++IAT Sbjct: 164 QDGKIDKIEWQNFVSKNPSLLKVMTLPYLRDITTTFPSFVFNSEVDEIAT 213 >ref|XP_004147242.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] Length = 213 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDK EW+ FVS NPSL+K+MTLPYLRDITTTFPSFVF SEV++IAT Sbjct: 164 QDGKIDKIEWQNFVSKNPSLLKVMTLPYLRDITTTFPSFVFNSEVDEIAT 213 >ref|NP_001267901.1| calcineurin B-like protein 01 [Vitis vinifera] gi|359474415|ref|XP_002275887.2| PREDICTED: calcineurin B-like protein 1-like [Vitis vinifera] gi|229609879|gb|ACQ83555.1| calcineurin B-like protein 01 [Vitis vinifera] gi|296083437|emb|CBI23390.3| unnamed protein product [Vitis vinifera] gi|296083439|emb|CBI23392.3| unnamed protein product [Vitis vinifera] gi|310913176|emb|CBW30483.1| calcineurin B-like protein 01 [Vitis vinifera] Length = 213 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDG+IDK+EW+ FVS NPSL+KIMTLPYLRDITTTFPSFVF SEV++IAT Sbjct: 164 QDGRIDKSEWQNFVSRNPSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT 213 >ref|XP_006662075.1| PREDICTED: calcineurin B-like protein 1-like [Oryza brachyantha] Length = 213 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDG+ID+TEWE FVS NPSL+KIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGRIDRTEWENFVSRNPSLLKIMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >ref|XP_006284521.1| hypothetical protein CARUB_v10005722mg [Capsella rubella] gi|482553226|gb|EOA17419.1| hypothetical protein CARUB_v10005722mg [Capsella rubella] Length = 213 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDK EW FV+ NPSL+KIMTLPYLRDITTTFPSFVF+SEV++IAT Sbjct: 164 QDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT 213 >ref|XP_006281094.1| hypothetical protein CARUB_v10027124mg [Capsella rubella] gi|482549798|gb|EOA13992.1| hypothetical protein CARUB_v10027124mg [Capsella rubella] Length = 213 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 +DGKIDKTEW FV NPSL+KIMTLPYLRDITTTFPSFVF+SEV++IAT Sbjct: 164 RDGKIDKTEWSNFVIKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT 213 >gb|ABA54176.1| calcineurin B-like protein 1 [Oryza sativa Japonica Group] Length = 213 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDG+ID+TEWE FVS NPSL+KIMTLPYL+DITTTFPSFVF SEV+D+ T Sbjct: 164 QDGRIDRTEWENFVSRNPSLLKIMTLPYLKDITTTFPSFVFNSEVDDLVT 213 >ref|NP_974566.1| calcineurin B-like protein 1 [Arabidopsis thaliana] gi|332658522|gb|AEE83922.1| calcineurin B-like protein 1 [Arabidopsis thaliana] Length = 171 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 512 QDGKIDKTEWETFVSCNPSLMKIMTLPYLRDITTTFPSFVFYSEVEDIAT 363 QDGKIDK EW FV+ NPSL+KIMTLPYLRDITTTFPSFVF+SEV++IAT Sbjct: 122 QDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT 171