BLASTX nr result
ID: Zingiber24_contig00031349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00031349 (670 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29555.1| DNA glycosylase superfamily protein isoform 1 [Th... 65 2e-08 ref|XP_006857230.1| hypothetical protein AMTR_s00065p00208780 [A... 64 5e-08 ref|XP_002309346.1| methyladenine glycosylase family protein [Po... 62 2e-07 ref|XP_003527169.1| PREDICTED: uncharacterized protein LOC100801... 61 3e-07 gb|EMJ06013.1| hypothetical protein PRUPE_ppa026720mg [Prunus pe... 60 5e-07 ref|XP_002276173.1| PREDICTED: probable GMP synthase [glutamine-... 60 6e-07 dbj|BAD38103.1| methyladenine glycosylase protein-like [Oryza sa... 59 1e-06 ref|NP_001058219.2| Os06g0649800 [Oryza sativa Japonica Group] g... 59 1e-06 gb|EEE66127.1| hypothetical protein OsJ_22173 [Oryza sativa Japo... 59 1e-06 gb|EAZ01894.1| hypothetical protein OsI_23919 [Oryza sativa Indi... 59 1e-06 ref|XP_002438758.1| hypothetical protein SORBIDRAFT_10g025650 [S... 58 2e-06 ref|XP_004158792.1| PREDICTED: probable GMP synthase [glutamine-... 58 3e-06 ref|XP_004136097.1| PREDICTED: probable GMP synthase [glutamine-... 58 3e-06 ref|XP_004965722.1| PREDICTED: uncharacterized protein LOC101779... 57 5e-06 ref|XP_002529378.1| DNA-3-methyladenine glycosylase, putative [R... 56 9e-06 >gb|EOY29555.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao] gi|508782300|gb|EOY29556.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao] gi|508782301|gb|EOY29557.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao] gi|508782302|gb|EOY29558.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao] Length = 379 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSGAP +RS NVADSEARPVL P GNKA SL ++RKPASKPL K Sbjct: 1 MSGAPRMRSMNVADSEARPVLGPAGNKAGSL-SARKPASKPLRK 43 >ref|XP_006857230.1| hypothetical protein AMTR_s00065p00208780 [Amborella trichopoda] gi|548861313|gb|ERN18697.1| hypothetical protein AMTR_s00065p00208780 [Amborella trichopoda] Length = 397 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSG P +RS NVAD+E RPVL P GNKARS+ T RKPASKPL K Sbjct: 1 MSGPPKIRSMNVADAEVRPVLGPAGNKARSIAT-RKPASKPLRK 43 >ref|XP_002309346.1| methyladenine glycosylase family protein [Populus trichocarpa] gi|222855322|gb|EEE92869.1| methyladenine glycosylase family protein [Populus trichocarpa] Length = 381 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/45 (75%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGN-KARSLTTSRKPASKPLNK 665 MSGAP VRS NVADSEARPVL P GN KA LT++RKPASK L K Sbjct: 1 MSGAPRVRSMNVADSEARPVLGPTGNTKAGPLTSARKPASKQLRK 45 >ref|XP_003527169.1| PREDICTED: uncharacterized protein LOC100801026 isoform X1 [Glycine max] gi|571461733|ref|XP_006582090.1| PREDICTED: uncharacterized protein LOC100801026 isoform X2 [Glycine max] gi|571461735|ref|XP_006582091.1| PREDICTED: uncharacterized protein LOC100801026 isoform X3 [Glycine max] Length = 383 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSGAP +RS NVADSEARPVL P GNK SL +SRK ASKPL K Sbjct: 1 MSGAPRLRSMNVADSEARPVLGPAGNKTGSL-SSRKTASKPLRK 43 >gb|EMJ06013.1| hypothetical protein PRUPE_ppa026720mg [Prunus persica] Length = 378 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSGAP VRS NVADSE+RPVL P GNKA + ++RKP SKPL K Sbjct: 1 MSGAPRVRSINVADSESRPVLGPAGNKAGTF-SARKPVSKPLRK 43 >ref|XP_002276173.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing] [Vitis vinifera] gi|297743642|emb|CBI36525.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSG P VRS NVADSE RPVL P GNK + RKPA+KPL K Sbjct: 1 MSGGPRVRSMNVADSEVRPVLGPAGNKTMRSLSGRKPATKPLRK 44 >dbj|BAD38103.1| methyladenine glycosylase protein-like [Oryza sativa Japonica Group] Length = 433 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS NVA D++ARPVLVPGGNKARS +RKP+ KPL K Sbjct: 5 MAGAPRVRSLNVAETDADARPVLVPGGNKARSGPAAARKPSPKPLRK 51 >ref|NP_001058219.2| Os06g0649800 [Oryza sativa Japonica Group] gi|255677280|dbj|BAF20133.2| Os06g0649800 [Oryza sativa Japonica Group] Length = 407 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS NVA D++ARPVLVPGGNKARS +RKP+ KPL K Sbjct: 5 MAGAPRVRSLNVAETDADARPVLVPGGNKARSGPAAARKPSPKPLRK 51 >gb|EEE66127.1| hypothetical protein OsJ_22173 [Oryza sativa Japonica Group] Length = 410 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS NVA D++ARPVLVPGGNKARS +RKP+ KPL K Sbjct: 5 MAGAPRVRSLNVAETDADARPVLVPGGNKARSGPAAARKPSPKPLRK 51 >gb|EAZ01894.1| hypothetical protein OsI_23919 [Oryza sativa Indica Group] Length = 426 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS NVA D++ARPVLVPGGNKARS +RKP+ KPL K Sbjct: 5 MAGAPRVRSLNVAETDADARPVLVPGGNKARSGPAAARKPSPKPLRK 51 >ref|XP_002438758.1| hypothetical protein SORBIDRAFT_10g025650 [Sorghum bicolor] gi|241916981|gb|EER90125.1| hypothetical protein SORBIDRAFT_10g025650 [Sorghum bicolor] Length = 412 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/47 (65%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS N+A ++EARPVLVPGGNKARS +RKP+ KPL K Sbjct: 1 MAGAPRVRSLNIAVPEAEARPVLVPGGNKARSGPANARKPSPKPLRK 47 >ref|XP_004158792.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like [Cucumis sativus] Length = 371 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSG P +RS NVADS++RPVL P GNKAR++ T RKP KPL K Sbjct: 1 MSGPPRIRSMNVADSDSRPVLGPTGNKARTVET-RKPGVKPLKK 43 >ref|XP_004136097.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like [Cucumis sativus] Length = 380 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSG P +RS NVADS++RPVL P GNKAR++ T RKP KPL K Sbjct: 1 MSGPPRIRSMNVADSDSRPVLGPTGNKARTVET-RKPGVKPLKK 43 >ref|XP_004965722.1| PREDICTED: uncharacterized protein LOC101779865 [Setaria italica] Length = 418 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = +3 Query: 534 MSGAPHVRSFNVA--DSEARPVLVPGGNKARS-LTTSRKPASKPLNK 665 M+GAP VRS N+A + EARPVLVPGGNKARS +RKP+ KPL K Sbjct: 4 MAGAPRVRSLNIAAPEVEARPVLVPGGNKARSGPANARKPSPKPLRK 50 >ref|XP_002529378.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis] gi|223531126|gb|EEF32974.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis] Length = 380 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +3 Query: 534 MSGAPHVRSFNVADSEARPVLVPGGNKARSLTTSRKPASKPLNK 665 MSGAP VRS NVADSE RPVL P GN +++KPASK L K Sbjct: 1 MSGAPRVRSMNVADSETRPVLGPTGNNKAGSLSAKKPASKQLRK 44