BLASTX nr result
ID: Zingiber24_contig00030985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00030985 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa... 58 1e-06 ref|XP_004231903.1| PREDICTED: subtilisin-like protease-like [So... 56 6e-06 >gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata] Length = 757 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -2 Query: 157 MAPLRFY-FFLSLLGCFCGCSISLAELRKKTYIVHMAKAQMPAAFAEHSRWYD 2 M PLR L LL C + ++A +K+TYIVHMAK+QMP AFAEH WYD Sbjct: 1 MEPLRSSSLMLLLLVICCSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYD 53 >ref|XP_004231903.1| PREDICTED: subtilisin-like protease-like [Solanum lycopersicum] Length = 754 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -2 Query: 109 CGCSISLAELRKKTYIVHMAKAQMPAAFAEHSRWYD 2 C C +S+A + KKTYI+HMAK+QMPA F +H+ WYD Sbjct: 13 CLCHMSVAMVEKKTYIIHMAKSQMPAIFDDHTHWYD 48