BLASTX nr result
ID: Zingiber24_contig00030948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00030948 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99723.1| hypothetical protein L484_023253 [Morus notabilis] 56 6e-06 >gb|EXB99723.1| hypothetical protein L484_023253 [Morus notabilis] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -2 Query: 130 MDHSRHSNQHQQLGVNKLGKNIRKSPLHQPTYYNHRPHPTPPP 2 MD+S+ N+H LGVNK+GKNIRKSPLHQP Y N+ P P Sbjct: 1 MDNSK--NRHDHLGVNKMGKNIRKSPLHQPNYNNNPARQQPQP 41