BLASTX nr result
ID: Zingiber24_contig00030374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00030374 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_004984910.1| conserved hypothetical protein, partial [Str... 95 5e-21 ref|WP_008748712.1| hypothetical protein, partial [Streptomyces ... 104 1e-20 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 95 1e-20 ref|WP_005311167.1| conserved hypothetical protein, partial [Str... 94 2e-20 ref|WP_005314063.1| conserved hypothetical protein, partial [Str... 94 4e-20 ref|WP_007381065.1| conserved hypothetical protein, partial [Str... 92 5e-20 ref|WP_004930641.1| hypothetical protein [Streptomyces griseofla... 97 2e-18 ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] ... 97 3e-18 ref|WP_007385104.1| conserved hypothetical protein, partial [Str... 84 8e-18 ref|WP_003993384.1| hypothetical protein [Streptomyces viridochr... 95 1e-17 ref|WP_006574686.1| hypothetical protein [Pseudoflavonifractor c... 94 2e-17 ref|WP_009714633.1| hypothetical protein, partial [Streptomyces ... 89 3e-17 ref|WP_009068222.1| conserved hypothetical protein, partial [Str... 83 4e-17 ref|WP_003975503.1| hypothetical protein [Streptomyces lividans]... 92 9e-17 ref|WP_006123540.1| conserved hypothetical protein, partial [Str... 86 7e-15 gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bact... 84 1e-14 ref|WP_008603367.1| cell wall-associated hydrolase, partial [Vei... 72 3e-12 ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella ... 72 4e-12 ref|WP_008715884.1| cell wall-associated hydrolase, partial [Vei... 72 4e-12 ref|WP_008746630.1| hypothetical protein, partial [Streptomyces ... 70 2e-10 >ref|WP_004984910.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291340927|gb|EFE67883.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341606|gb|EFE68562.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342163|gb|EFE69119.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343781|gb|EFE70737.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 74 Score = 94.7 bits (234), Expect(2) = 5e-21 Identities = 43/53 (81%), Positives = 45/53 (84%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G PHLEA FPLRCFQRLSLPNVANQ C W++NWHTRGSSVPVLSY Sbjct: 22 GALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 32.0 bits (71), Expect(2) = 5e-21 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P +T LP PAYQP+ Sbjct: 1 YRSPPHVTVLPDPAYQPS 18 >ref|WP_008748712.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827601|gb|EDY46972.2| hypothetical protein SSBG_04935 [Streptomyces sp. SPB74] Length = 77 Score = 104 bits (260), Expect = 1e-20 Identities = 49/70 (70%), Positives = 53/70 (75%) Frame = +2 Query: 2 ISTGQLHALLRFHLRPINPLVWAGALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSW 181 ISTGQLH FH+RPINP+V+ P G HLEA FPLRCFQRLSLPNVANQ C W Sbjct: 8 ISTGQLHPSQGFHIRPINPVVYWEPYPLKGGGNTHLEAGFPLRCFQRLSLPNVANQPCPW 67 Query: 182 RNNWHTRGSS 211 +NNWHTRGSS Sbjct: 68 QNNWHTRGSS 77 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 94.7 bits (234), Expect(2) = 1e-20 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G HLEA FPLRCFQRLSLPNVANQ C W+NNWHTRGSSVPVLSY Sbjct: 22 GALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 74 Score = 30.4 bits (67), Expect(2) = 1e-20 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P +T LP PAYQP+ Sbjct: 1 YRSTPPLTGLPYPAYQPS 18 >ref|WP_005311167.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151020|gb|EDY65528.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151807|gb|EFH31361.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 94.0 bits (232), Expect(2) = 2e-20 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G PHLEA FPLRCFQRLS PNVANQ C W++NWHTRGSSVPVLSY Sbjct: 22 GALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 30.4 bits (67), Expect(2) = 2e-20 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P +T LP PAYQP+ Sbjct: 1 YRSTPPLTGLPYPAYQPS 18 >ref|WP_005314063.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151538|gb|EDY66056.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152877|gb|EFH32044.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 94.0 bits (232), Expect(2) = 4e-20 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G PHLEA FPLRCFQRLS PNVANQ C W++NWHTRGSSVPVLSY Sbjct: 22 GALPSQGGGSPHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 29.6 bits (65), Expect(2) = 4e-20 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P T LP PAYQP+ Sbjct: 1 YRSTPPFTGLPYPAYQPS 18 >ref|WP_007381065.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297147181|gb|EFH28519.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147699|gb|EFH28707.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147892|gb|EFH28779.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 74 Score = 91.7 bits (226), Expect(2) = 5e-20 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GAL G PHLEA FPLRCFQRLSLPNVANQ C W++NWHTRGSSVPVLSY Sbjct: 22 GALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 74 Score = 31.6 bits (70), Expect(2) = 5e-20 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P IT LP PAYQP+ Sbjct: 1 YRSPPPITGLPDPAYQPS 18 >ref|WP_004930641.1| hypothetical protein [Streptomyces griseoflavus] gi|302477944|gb|EFL41037.1| hypothetical protein SSRG_03841 [Streptomyces griseoflavus Tu4000] Length = 66 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G PHLEA FPLRCFQRLSLPNVANQ C W+NNWHTRGSSVPVLSY Sbjct: 14 GALPSLGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 >ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] gi|292830510|gb|EFF88860.1| hypothetical protein SSTG_04730 [Streptomyces sp. e14] gi|292831950|gb|EFF90299.1| hypothetical protein SSTG_00617 [Streptomyces sp. e14] gi|292833022|gb|EFF91371.1| hypothetical protein SSTG_01690 [Streptomyces sp. e14] gi|292833480|gb|EFF91829.1| hypothetical protein SSTG_02148 [Streptomyces sp. e14] gi|292834018|gb|EFF92367.1| hypothetical protein SSTG_02686 [Streptomyces sp. e14] Length = 66 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G PHLEA FPLRCFQRLSLPNVANQ C W+NNWHTRGSSVPVLSY Sbjct: 14 GALPHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 >ref|WP_007385104.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297148196|gb|EFH28880.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 70 Score = 84.3 bits (207), Expect(2) = 8e-18 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVP 217 GAL G PHLEA FPLRCFQRLSLPNVANQ C W++NWHTRGSSVP Sbjct: 22 GALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVP 70 Score = 31.6 bits (70), Expect(2) = 8e-18 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P IT LP PAYQP+ Sbjct: 1 YRSPPPITGLPDPAYQPS 18 >ref|WP_003993384.1| hypothetical protein [Streptomyces viridochromogenes] gi|302472168|gb|EFL35261.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 66 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GALP G HLEA FPLRCFQRLSLPNVANQ C W+NNWHTRGSSVPVLSY Sbjct: 14 GALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLSY 66 >ref|WP_006574686.1| hypothetical protein [Pseudoflavonifractor capillosus] gi|150270400|gb|EDM97723.1| hypothetical protein BACCAP_04464 [Pseudoflavonifractor capillosus ATCC 29799] gi|150270680|gb|EDM97982.1| hypothetical protein BACCAP_04210 [Pseudoflavonifractor capillosus ATCC 29799] Length = 83 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/76 (60%), Positives = 53/76 (69%) Frame = +2 Query: 2 ISTGQLHALLRFHLRPINPLVWAGALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSW 181 ISTGQLH L FHLRPIN +V+ ERPHL SF LRC QRLS P +A Q C W Sbjct: 9 ISTGQLHVLPHFHLRPINDVVYIEPYLT-KSERPHLRGSFTLRCLQRLSRPYIATQLCPW 67 Query: 182 RNNWHTRGSSVPVLSY 229 ++NW TRG+S+PVLSY Sbjct: 68 QDNWCTRGTSIPVLSY 83 >ref|WP_009714633.1| hypothetical protein, partial [Streptomyces himastatinicus] gi|302459719|gb|EFL22812.1| LOW QUALITY PROTEIN: hypothetical protein SSOG_02526 [Streptomyces himastatinicus ATCC 53653] Length = 74 Score = 89.0 bits (219), Expect(2) = 3e-17 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GAL G PHLEA FPLRCFQRLSLPNVANQ C W++NWHT GSSVPVLSY Sbjct: 22 GALTHQVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTGGSSVPVLSY 74 Score = 25.0 bits (53), Expect(2) = 3e-17 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 Y+S P +T LP AYQP+ Sbjct: 1 YQSTPPVTRLPYLAYQPS 18 >ref|WP_009068222.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302430314|gb|EFL02130.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 68 Score = 83.2 bits (204), Expect(2) = 4e-17 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSS 211 GALP G HLEA FPLRCFQRLSLPNVANQ C W+NNWHTRGSS Sbjct: 22 GALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 68 Score = 30.4 bits (67), Expect(2) = 4e-17 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 7 YRSAPRITALPPPAYQPA 60 YRS P +T LP PAYQP+ Sbjct: 1 YRSTPPLTGLPYPAYQPS 18 >ref|WP_003975503.1| hypothetical protein [Streptomyces lividans] gi|289701157|gb|EFD68586.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289701450|gb|EFD68879.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289702690|gb|EFD70119.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289703100|gb|EFD70529.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +2 Query: 71 GALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 GAL G PHLEA FPLRCFQRLSLPNVANQ C W++NWHTRGSSVPVLSY Sbjct: 14 GALTPQGGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 66 >ref|WP_006123540.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346639|gb|EFE73543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348565|gb|EFE75469.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348853|gb|EFE75757.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +2 Query: 92 GERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 G HLEA FPLRCFQRLS PNVANQ C W++NWHTRGSSVPVLSY Sbjct: 5 GGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 50 >gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 84.3 bits (207), Expect = 1e-14 Identities = 43/76 (56%), Positives = 51/76 (67%) Frame = +2 Query: 2 ISTGQLHALLRFHLRPINPLVWAGALPG*PGERPHLEASFPLRCFQRLSLPNVANQQCSW 181 IST +LH LLRFH+ PIN +V+ G+ R + FPLRCFQRLS P VA QC W Sbjct: 55 ISTRKLHTLLRFHIVPINVVVYNGSQG-----RTRFQVGFPLRCFQRLSRPYVATLQCGW 109 Query: 182 RNNWHTRGSSVPVLSY 229 R+N TRG+S PVLSY Sbjct: 110 RHNRSTRGTSTPVLSY 125 >ref|WP_008603367.1| cell wall-associated hydrolase, partial [Veillonella sp. 6_1_27] gi|294456247|gb|EFG24611.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0874_01772, partial [Veillonella sp. 6_1_27] Length = 83 Score = 72.4 bits (176), Expect(2) = 3e-12 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 95 ERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 E+PHL+A F LRCFQRLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 39 EKPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLSY 83 Score = 24.6 bits (52), Expect(2) = 3e-12 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 LVPVSSTHYCASTSGLST 56 LVPVSS + +ST GLST Sbjct: 9 LVPVSSNPHGSSTPGLST 26 >ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella sp. 3_1_44] gi|294453908|gb|EFG22289.1| hypothetical protein HMPREF0873_01868 [Veillonella sp. 3_1_44] Length = 94 Score = 72.4 bits (176), Expect(2) = 4e-12 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 95 ERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 E+PHL+A F LRCFQRLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 50 EKPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLSY 94 Score = 24.3 bits (51), Expect(2) = 4e-12 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 LVPVSSTHYCASTSGLST 56 LVPVSS + +ST GLST Sbjct: 20 LVPVSSKPHGSSTPGLST 37 >ref|WP_008715884.1| cell wall-associated hydrolase, partial [Veillonella sp. 3_1_44] gi|294453902|gb|EFG22286.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0873_01871, partial [Veillonella sp. 3_1_44] Length = 83 Score = 72.4 bits (176), Expect(2) = 4e-12 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 95 ERPHLEASFPLRCFQRLSLPNVANQQCSWRNNWHTRGSSVPVLSY 229 E+PHL+A F LRCFQRLS+PNVA Q W++NW+T GSS PVLSY Sbjct: 39 EKPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLSY 83 Score = 24.3 bits (51), Expect(2) = 4e-12 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 3 LVPVSSTHYCASTSGLST 56 LVPVSS + +ST GLST Sbjct: 9 LVPVSSKPHGSSTPGLST 26 >ref|WP_008746630.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295826562|gb|EDY44842.2| LOW QUALITY PROTEIN: hypothetical protein SSBG_02741 [Streptomyces sp. SPB74] gi|295827792|gb|EFG65600.1| LOW QUALITY PROTEIN: hypothetical protein SSBG_06429 [Streptomyces sp. SPB74] Length = 60 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = +2 Query: 2 ISTGQLHALLRFHLRPINPLVWAGALPG*PGERPHLEASFPLRCFQRLSLPNV 160 ISTGQLH FH+RPINP+V+ P G HLEA FPLRCFQRLSLPNV Sbjct: 8 ISTGQLHPSQGFHIRPINPVVYWEPYPLKGGGNTHLEAGFPLRCFQRLSLPNV 60