BLASTX nr result
ID: Zingiber24_contig00029966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00029966 (596 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, p... 73 5e-11 >gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, partial [Zingiber zerumbet] Length = 759 Score = 73.2 bits (178), Expect = 5e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 595 LQYLNLSSNPITRLSAKFGCLIKLEYLLLRYTNLEIVPNGTI 470 LQYLNLSSNPITRL +FGCL KLEYLLLR TNL+IVPNGTI Sbjct: 718 LQYLNLSSNPITRLPIEFGCLSKLEYLLLRDTNLKIVPNGTI 759