BLASTX nr result
ID: Zingiber24_contig00029444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00029444 (432 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535844.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >ref|XP_003535844.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Glycine max] Length = 600 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = +3 Query: 3 LLQAYVTAKTPVYGFRDRMKADNMCPNRTXXXXXXXXXXXXNNPISELL 149 L+QAYV AK P YG R+RMKADN+ PN+T NP+S+LL Sbjct: 551 LMQAYVNAKVPAYGIRERMKADNLFPNKTLANQLFLVDAFRKNPVSDLL 599