BLASTX nr result
ID: Zingiber24_contig00029225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00029225 (259 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS47041.1| hypothetical protein TRIUR3_04150 [Triticum urartu] 55 8e-06 >gb|EMS47041.1| hypothetical protein TRIUR3_04150 [Triticum urartu] Length = 522 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +2 Query: 20 SKLRDKASPLITVLSSF-PSAEMLQAMRILFANKTNGSNFMDITFDASKRSMEIPQLLIN 196 S+ R ++ L++ L + P A+ L+ + F + N ++FMD+ F ++ +EIPQL +N Sbjct: 324 SRRRRRSDELLSELPQWIPCAKELEESGVRFRKRKNATSFMDVRF--ARGVLEIPQLELN 381 Query: 197 DDNISLLRNLIAFEQQFHGVP 259 D + SL RNLIAFEQ + P Sbjct: 382 DSSESLFRNLIAFEQTYPDTP 402