BLASTX nr result
ID: Zingiber24_contig00028095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00028095 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY31163.1| Uncharacterized protein TCM_038148 [Theobroma cacao] 75 7e-12 ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabac... 74 2e-11 emb|CBI23503.3| unnamed protein product [Vitis vinifera] 65 7e-09 >gb|EOY31163.1| Uncharacterized protein TCM_038148 [Theobroma cacao] Length = 538 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -3 Query: 335 QQVRHLLEKRESTSDNHVCARQRVEWPRADPEGYIIQAESGV 210 +QVRHLLEKRESTSDNH ARQRVEWPRAD GYIIQ ESGV Sbjct: 492 EQVRHLLEKRESTSDNHASARQRVEWPRADLFGYIIQVESGV 533 >ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabacum] gi|56806590|dbj|BAD83491.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 162 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -3 Query: 335 QQVRHLLEKRESTSDNHVCARQRVEWPRADPEGYIIQAESGV 210 QQVRHLL+KRESTSDNHV ARQRVEWPRAD GYIIQ ES V Sbjct: 116 QQVRHLLQKRESTSDNHVSARQRVEWPRADLFGYIIQVESRV 157 >emb|CBI23503.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 4/40 (10%) Frame = -1 Query: 376 KGRGPCSCCARPL----SSRFGIY*KRENPLQITTSVLGS 269 KGRGPCSCCARPL SRFGIY KRENPLQITT +LGS Sbjct: 205 KGRGPCSCCARPLLSQWGSRFGIYYKRENPLQITTPLLGS 244