BLASTX nr result
ID: Zingiber24_contig00028014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00028014 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK26343.1| unknown [Picea sitchensis] 80 3e-13 dbj|BAA92173.1| uncoupling protein b [Symplocarpus renifolius] 78 1e-12 dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] 78 1e-12 dbj|BAD51464.1| uncoupling protein a [Dracunculus vulgaris] 77 3e-12 dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros ... 77 3e-12 dbj|BAL41370.1| uncoupling protein [Arum maculatum] 77 3e-12 dbj|BAA92172.1| uncoupling protein a [Symplocarpus renifolius] 75 9e-12 dbj|BAI49702.1| uncoupling protein a [Symplocarpus renifolius] 75 9e-12 dbj|BAB40658.1| uncoupling protein [Oryza sativa Japonica Group] 70 4e-10 ref|XP_006663135.1| PREDICTED: mitochondrial uncoupling protein ... 70 4e-10 ref|NP_001068559.2| Os11g0707800 [Oryza sativa Japonica Group] g... 70 4e-10 gb|AFW60054.1| thioesterase family protein, mRNA [Zea mays] 70 4e-10 ref|NP_001182792.1| mitochondrial uncoupling protein 3 [Zea mays... 70 4e-10 gb|AAX95421.1| Mitochondrial carrier protein, putative [Oryza sa... 70 4e-10 gb|AAU11463.1| mitochondrial uncoupling protein 2 [Saccharum off... 70 4e-10 ref|NP_001105727.1| LOC542748 [Zea mays] gi|19401698|gb|AAL87666... 70 4e-10 ref|XP_002520442.1| mitochondrial uncoupling protein, putative [... 69 5e-10 ref|XP_004980093.1| PREDICTED: mitochondrial uncoupling protein ... 69 6e-10 ref|XP_002450079.1| hypothetical protein SORBIDRAFT_05g027910 [S... 69 6e-10 ref|XP_006424994.1| hypothetical protein CICLE_v10028916mg [Citr... 69 8e-10 >gb|ABK26343.1| unknown [Picea sitchensis] Length = 304 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKKLFA+EVP Sbjct: 266 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFAREVP 303 >dbj|BAA92173.1| uncoupling protein b [Symplocarpus renifolius] Length = 268 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KEVP Sbjct: 230 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 267 >dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] Length = 304 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KEVP Sbjct: 266 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 303 >dbj|BAD51464.1| uncoupling protein a [Dracunculus vulgaris] Length = 304 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK+F KE P Sbjct: 267 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304 >dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros muscivorus] Length = 304 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK+F KE P Sbjct: 267 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304 >dbj|BAL41370.1| uncoupling protein [Arum maculatum] Length = 304 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 PLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK+F KE P Sbjct: 267 PLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304 >dbj|BAA92172.1| uncoupling protein a [Symplocarpus renifolius] Length = 303 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 246 LAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 LAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KEVP Sbjct: 266 LAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 302 >dbj|BAI49702.1| uncoupling protein a [Symplocarpus renifolius] Length = 304 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 246 LAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEVP 136 LAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KEVP Sbjct: 267 LAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 303 >dbj|BAB40658.1| uncoupling protein [Oryza sativa Japonica Group] Length = 300 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 262 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 297 >ref|XP_006663135.1| PREDICTED: mitochondrial uncoupling protein 1-like [Oryza brachyantha] Length = 301 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 263 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 298 >ref|NP_001068559.2| Os11g0707800 [Oryza sativa Japonica Group] gi|77552733|gb|ABA95530.1| Mitochondrial carrier protein, expressed [Oryza sativa Japonica Group] gi|215692434|dbj|BAG87854.1| unnamed protein product [Oryza sativa Japonica Group] gi|222616453|gb|EEE52585.1| hypothetical protein OsJ_34888 [Oryza sativa Japonica Group] gi|255680413|dbj|BAF28922.2| Os11g0707800 [Oryza sativa Japonica Group] Length = 301 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 263 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 298 >gb|AFW60054.1| thioesterase family protein, mRNA [Zea mays] Length = 143 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 105 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 140 >ref|NP_001182792.1| mitochondrial uncoupling protein 3 [Zea mays] gi|195629868|gb|ACG36575.1| mitochondrial uncoupling protein 3 [Zea mays] Length = 340 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 302 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 337 >gb|AAX95421.1| Mitochondrial carrier protein, putative [Oryza sativa Japonica Group] Length = 304 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 266 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 301 >gb|AAU11463.1| mitochondrial uncoupling protein 2 [Saccharum officinarum] Length = 309 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 271 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 306 >ref|NP_001105727.1| LOC542748 [Zea mays] gi|19401698|gb|AAL87666.1|AF461732_1 uncoupling protein [Zea mays] gi|219888231|gb|ACL54490.1| unknown [Zea mays] gi|413920124|gb|AFW60056.1| uncoupling protein 3 [Zea mays] gi|413920125|gb|AFW60057.1| uncoupling protein 3 [Zea mays] Length = 310 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+KLF ++ Sbjct: 272 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKLFVRK 307 >ref|XP_002520442.1| mitochondrial uncoupling protein, putative [Ricinus communis] gi|223540284|gb|EEF41855.1| mitochondrial uncoupling protein, putative [Ricinus communis] Length = 305 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 243 AFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEV 139 AFYKGFLPNFGRLGSWNVIMFLTLEQVK++F +E+ Sbjct: 268 AFYKGFLPNFGRLGSWNVIMFLTLEQVKRIFTREM 302 >ref|XP_004980093.1| PREDICTED: mitochondrial uncoupling protein 1-like [Setaria italica] Length = 302 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+K+F ++ Sbjct: 264 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKMFVRK 299 >ref|XP_002450079.1| hypothetical protein SORBIDRAFT_05g027910 [Sorghum bicolor] gi|241935922|gb|EES09067.1| hypothetical protein SORBIDRAFT_05g027910 [Sorghum bicolor] Length = 381 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 249 PLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKE 142 PLAFYKGFLPNF RLGSWNVIMFLTLEQV+K+F ++ Sbjct: 343 PLAFYKGFLPNFARLGSWNVIMFLTLEQVQKMFVRK 378 >ref|XP_006424994.1| hypothetical protein CICLE_v10028916mg [Citrus clementina] gi|567864692|ref|XP_006424995.1| hypothetical protein CICLE_v10028916mg [Citrus clementina] gi|557526928|gb|ESR38234.1| hypothetical protein CICLE_v10028916mg [Citrus clementina] gi|557526929|gb|ESR38235.1| hypothetical protein CICLE_v10028916mg [Citrus clementina] Length = 245 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 246 LAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAKEV 139 LAFYKGFLPNF RLGSWNVIMFLTLEQ KK+F +EV Sbjct: 207 LAFYKGFLPNFSRLGSWNVIMFLTLEQAKKVFIREV 242