BLASTX nr result
ID: Zingiber24_contig00027698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00027698 (490 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004962524.1| PREDICTED: uncharacterized protein LOC101760... 58 1e-06 >ref|XP_004962524.1| PREDICTED: uncharacterized protein LOC101760521 [Setaria italica] Length = 316 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 410 PPSPMARDATSTWSDLLGGVISESHRIVAAHSRHFLALSVLFLLPFSSILV 258 PP P T W DLL G S + R++AAHSRHFLALS L LLP + +L+ Sbjct: 6 PPPPSLPPVTLPWPDLLAGAASSTRRLIAAHSRHFLALSSLLLLPLALLLL 56