BLASTX nr result
ID: Zingiber24_contig00027439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00027439 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351711.1| PREDICTED: putative glutamine amidotransfera... 69 5e-10 ref|XP_004982153.1| PREDICTED: putative glutamine amidotransfera... 68 1e-09 ref|XP_004230625.1| PREDICTED: putative glutamine amidotransfera... 68 1e-09 ref|XP_006650418.1| PREDICTED: putative glutamine amidotransfera... 67 2e-09 ref|XP_002532757.1| GMP synthase, putative [Ricinus communis] gi... 67 2e-09 ref|XP_006487691.1| PREDICTED: putative glutamine amidotransfera... 66 4e-09 ref|XP_002313218.1| hypothetical protein POPTR_0009s08190g [Popu... 66 4e-09 gb|EMS49165.1| hypothetical protein TRIUR3_11461 [Triticum urartu] 66 5e-09 ref|XP_004167823.1| PREDICTED: LOW QUALITY PROTEIN: putative glu... 66 5e-09 ref|XP_004147509.1| PREDICTED: putative glutamine amidotransfera... 66 5e-09 ref|XP_003561198.1| PREDICTED: putative glutamine amidotransfera... 66 5e-09 dbj|BAJ97854.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 dbj|BAJ85681.1| predicted protein [Hordeum vulgare subsp. vulgar... 65 7e-09 tpg|DAA50719.1| TPA: hypothetical protein ZEAMMB73_611400 [Zea m... 64 2e-08 gb|ACN36409.1| unknown [Zea mays] gi|414872164|tpg|DAA50721.1| T... 64 2e-08 ref|NP_001151007.1| LOC100284640 [Zea mays] gi|195643588|gb|ACG4... 64 2e-08 ref|XP_004136902.1| PREDICTED: putative glutamine amidotransfera... 63 5e-08 gb|AFW67968.1| defense protein [Zea mays] gi|413933418|gb|AFW679... 63 5e-08 gb|AFW67966.1| hypothetical protein ZEAMMB73_924214 [Zea mays] 63 5e-08 ref|XP_002324516.1| glutamine amidotransferase class-I domain-co... 62 6e-08 >ref|XP_006351711.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Solanum tuberosum] Length = 242 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY KDI LHL+DRLLQ NLI+ A+ AK ++ E DRE WK+LC FLKG L Sbjct: 189 EYTKDILLHLIDRLLQHNLIEESMADVAKAKVEEREPDREQWKKLCISFLKGKL 242 >ref|XP_004982153.1| PREDICTED: putative glutamine amidotransferase-like protein C13C5.04-like [Setaria italica] Length = 273 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLLQR+LI C + AK S D + D+E WK++C+GFLKG L Sbjct: 208 EYSKDILMSIADRLLQRSLILDCQVDVAKASFDVRQPDKELWKKVCRGFLKGRL 261 >ref|XP_004230625.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Solanum lycopersicum] Length = 242 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY KDI LHL+DRLLQ NLI+ A+ AK ++ E DRE WK+LC FLKG L Sbjct: 189 EYTKDILLHLIDRLLQHNLIEESMADVAKAKVEECEPDREQWKKLCISFLKGKL 242 >ref|XP_006650418.1| PREDICTED: putative glutamine amidotransferase-like protein C13C5.04-like [Oryza brachyantha] Length = 293 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL+ NLI C + AK S D + D+E WK++C+GFLKG L Sbjct: 218 EYSKDILMSIADRLLRNNLILDCQVDSAKASFDVRQPDKELWKKVCRGFLKGRL 271 >ref|XP_002532757.1| GMP synthase, putative [Ricinus communis] gi|223527486|gb|EEF29614.1| GMP synthase, putative [Ricinus communis] Length = 243 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY +DI LHL+DRLLQR LI A++ K ++D E DREAW+++C FLK L Sbjct: 190 EYTRDILLHLIDRLLQRGLIMDSFADEIKENLDEQEPDREAWRKMCTNFLKSRL 243 >ref|XP_006487691.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Citrus sinensis] Length = 245 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY KDI LHL+DRLLQRN I AE+A+ ++ E DRE WK++C FLKG L Sbjct: 192 EYTKDILLHLIDRLLQRNFIVDSIAEEARARVEELEPDREMWKKVCINFLKGRL 245 >ref|XP_002313218.1| hypothetical protein POPTR_0009s08190g [Populus trichocarpa] gi|222849626|gb|EEE87173.1| hypothetical protein POPTR_0009s08190g [Populus trichocarpa] Length = 241 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKG 158 EY KDI HL++RLLQR+ I +A+K K ++D E DREAWK+LC FLKG Sbjct: 190 EYTKDILFHLINRLLQRDFIVDSYADKIKANVDGTEPDREAWKKLCINFLKG 241 >gb|EMS49165.1| hypothetical protein TRIUR3_11461 [Triticum urartu] Length = 120 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL++NL+ C + AK S D + D+E WK++C+GFLKG L Sbjct: 50 EYSKDILMSIADRLLRQNLLLDCQVDVAKASFDVRQPDKEFWKKVCRGFLKGRL 103 >ref|XP_004167823.1| PREDICTED: LOW QUALITY PROTEIN: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Length = 243 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY KDI LHL+DRL+ R LI AE+ + +++ E DREAWKRLC FLKG L Sbjct: 190 EYTKDILLHLIDRLVLRKLITDEFAEEMRSNVEEGEADREAWKRLCINFLKGGL 243 >ref|XP_004147509.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Length = 243 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY KDI LHL+DRL+ R LI AE+ + +++ E DREAWKRLC FLKG L Sbjct: 190 EYTKDILLHLIDRLVLRKLITDEFAEEMRSNVEEGEADREAWKRLCINFLKGGL 243 >ref|XP_003561198.1| PREDICTED: putative glutamine amidotransferase-like protein C13C5.04-like [Brachypodium distachyon] Length = 282 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLLQR+LI C + AK S D + D+E WK++C+GFLK L Sbjct: 218 EYSKDILMSIADRLLQRDLILDCQVDVAKASFDVRQPDKELWKKVCRGFLKARL 271 >dbj|BAJ97854.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 320 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL++NL+ C + AK S D + D+E WK++C+GFLKG L Sbjct: 252 EYSKDILMSIADRLLRQNLLLGCQVDVAKASFDVRQPDKEFWKKVCRGFLKGRL 305 >dbj|BAJ85681.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326496350|dbj|BAJ94637.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 283 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL++NL+ C + AK S D + D+E WK++C+GFLKG L Sbjct: 215 EYSKDILMSIADRLLRQNLLLGCQVDVAKASFDVRQPDKEFWKKVCRGFLKGRL 268 >tpg|DAA50719.1| TPA: hypothetical protein ZEAMMB73_611400 [Zea mays] Length = 172 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL+ N I C + AK S D + D+E WK++C+GFLKG L Sbjct: 112 EYSKDILMSIADRLLRHNHILDCQVDVAKASFDVRQPDKELWKKVCRGFLKGRL 165 >gb|ACN36409.1| unknown [Zea mays] gi|414872164|tpg|DAA50721.1| TPA: defense protein [Zea mays] Length = 275 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL+ N I C + AK S D + D+E WK++C+GFLKG L Sbjct: 215 EYSKDILMSIADRLLRHNHILDCQVDVAKASFDVRQPDKELWKKVCRGFLKGRL 268 >ref|NP_001151007.1| LOC100284640 [Zea mays] gi|195643588|gb|ACG41262.1| defense-related protein [Zea mays] Length = 272 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KDI + + DRLL+ N I C + AK S D + D+E WK++C+GFLKG L Sbjct: 216 EYSKDILMSIADRLLRHNHILDCQVDVAKASFDVRQPDKELWKKVCRGFLKGRL 269 >ref|XP_004136902.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Length = 257 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKG 158 EY DI LHL+DRL+Q NLI +A++ K ++ E +REAWK+LC FLKG Sbjct: 191 EYTMDILLHLIDRLVQHNLIMETYAKELKVKVEDGEPEREAWKKLCINFLKG 242 >gb|AFW67968.1| defense protein [Zea mays] gi|413933418|gb|AFW67969.1| defense protein [Zea mays] Length = 278 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KD+ + + DRLL+ N I C E AK S D + D+E W ++C+GFLKG L Sbjct: 215 EYSKDVLMSIADRLLRHNHILDCQVEVAKTSFDVRQPDKELWSKVCRGFLKGRL 268 >gb|AFW67966.1| hypothetical protein ZEAMMB73_924214 [Zea mays] Length = 109 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKGNL 164 EY+KD+ + + DRLL+ N I C E AK S D + D+E W ++C+GFLKG L Sbjct: 46 EYSKDVLMSIADRLLRHNHILDCQVEVAKTSFDVRQPDKELWSKVCRGFLKGRL 99 >ref|XP_002324516.1| glutamine amidotransferase class-I domain-containing family protein [Populus trichocarpa] gi|222865950|gb|EEF03081.1| glutamine amidotransferase class-I domain-containing family protein [Populus trichocarpa] Length = 249 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = +3 Query: 3 EYNKDIFLHLVDRLLQRNLIQTCHAEKAKRSIDTHELDREAWKRLCKGFLKG 158 EY KDI +L+DRLL N I++ AEKAK ++ E DR+ W+++CK FLKG Sbjct: 197 EYTKDILYNLIDRLLSNNCIESAFAEKAKFGLEIAEPDRKCWEKICKNFLKG 248