BLASTX nr result
ID: Zingiber24_contig00026855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00026855 (395 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001060642.1| Os07g0679700 [Oryza sativa Japonica Group] g... 57 3e-06 gb|EEE67824.1| hypothetical protein OsJ_25593 [Oryza sativa Japo... 57 3e-06 gb|EEC82689.1| hypothetical protein OsI_27346 [Oryza sativa Indi... 57 3e-06 ref|XP_003562447.1| PREDICTED: B3 domain-containing protein Os07... 56 4e-06 ref|XP_006658132.1| PREDICTED: B3 domain-containing protein Os07... 55 7e-06 >ref|NP_001060642.1| Os07g0679700 [Oryza sativa Japonica Group] gi|75133539|sp|Q6Z3U3.1|Y7797_ORYSJ RecName: Full=B3 domain-containing protein Os07g0679700 gi|34394741|dbj|BAC84102.1| VP1/ABI3 family regulatory protein-like [Oryza sativa Japonica Group] gi|113612178|dbj|BAF22556.1| Os07g0679700 [Oryza sativa Japonica Group] Length = 949 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 285 KCMNVACGATEP---GGEWRRGRGLTSGGFASLCVKCGMA 395 +CMN ACGA P GGEWR+G L SGGFA LC KCG+A Sbjct: 16 RCMNAACGAPAPSPAGGEWRKGWPLRSGGFAVLCDKCGLA 55 >gb|EEE67824.1| hypothetical protein OsJ_25593 [Oryza sativa Japonica Group] Length = 949 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 285 KCMNVACGATEP---GGEWRRGRGLTSGGFASLCVKCGMA 395 +CMN ACGA P GGEWR+G L SGGFA LC KCG+A Sbjct: 16 RCMNAACGAPAPFPAGGEWRKGWPLRSGGFAVLCDKCGLA 55 >gb|EEC82689.1| hypothetical protein OsI_27346 [Oryza sativa Indica Group] Length = 947 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 285 KCMNVACGATEP---GGEWRRGRGLTSGGFASLCVKCGMA 395 +CMN ACGA P GGEWR+G L SGGFA LC KCG+A Sbjct: 16 RCMNAACGAPAPSPAGGEWRKGWPLRSGGFAVLCDKCGLA 55 >ref|XP_003562447.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Brachypodium distachyon] Length = 943 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = +3 Query: 285 KCMNVACGATEPG-----GEWRRGRGLTSGGFASLCVKCGMA 395 +CMN ACGA PG GEWR+G L SGGFA LC KCG+A Sbjct: 8 RCMNTACGAAAPGVGGAAGEWRKGWPLRSGGFAVLCDKCGLA 49 >ref|XP_006658132.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Oryza brachyantha] Length = 953 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +3 Query: 285 KCMNVACGATEP---GGEWRRGRGLTSGGFASLCVKCGMA 395 +CMN ACGA P GGEWR+G L SGG+A LC KCG+A Sbjct: 13 RCMNAACGAPAPSPAGGEWRKGWPLRSGGYAVLCDKCGLA 52