BLASTX nr result
ID: Zingiber24_contig00026567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00026567 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70012.1| hypothetical protein MA4_8L21.30 [Musa acuminata] 72 1e-10 >gb|ABF70012.1| hypothetical protein MA4_8L21.30 [Musa acuminata] Length = 1015 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/72 (47%), Positives = 47/72 (65%) Frame = -3 Query: 283 KNANFSLVLGLIRFVCFKMFENKSVPSERLQVTNSYLRKVYQLIAKELEEHQEGEDERHH 104 K A+FSLV GL+ F C KM N+S P E L++T+ L+K+YQ I + L +H +D RH Sbjct: 944 KRADFSLVFGLVHFTCMKMLGNESAPLEELELTSCSLQKIYQWIEQHLRDHHINKDGRHQ 1003 Query: 103 LVSALKFIESIL 68 L SA I+S+L Sbjct: 1004 LESAHSLIQSLL 1015