BLASTX nr result
ID: Zingiber24_contig00025888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00025888 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] 65 7e-09 gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] 65 9e-09 gb|AAW34137.1| cysteine protease gp3b [Zingiber officinale] 64 2e-08 gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale] 63 5e-08 gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii] 62 1e-07 gb|EMS56635.1| Oryzain alpha chain [Triticum urartu] 62 1e-07 dbj|BAF02546.1| triticain alpha [Triticum aestivum] gi|388890585... 62 1e-07 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] 58 1e-06 ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi... 57 2e-06 gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus n... 57 3e-06 dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare... 57 3e-06 gb|AFK47737.1| unknown [Medicago truncatula] 56 4e-06 ref|XP_003580684.1| PREDICTED: oryzain alpha chain-like [Brachyp... 56 4e-06 gb|ABR19827.1| cysteine proteinase [Elaeis guineensis] 56 4e-06 ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [S... 56 6e-06 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus... 56 6e-06 gb|AFO83613.1| papain-like cysteine protease [Fagopyrum esculentum] 56 6e-06 gb|EPS71857.1| senescence-associated cysteine protease, partial ... 56 6e-06 >gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] Length = 381 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSDEEVR+LYLEWR K+ P + LD + R E+FK+NL +VDEHNA Sbjct: 44 RSDEEVRMLYLEWRVKNHPAEKYLDLNEYRLEVFKENLQFVDEHNA 89 >gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] Length = 379 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSDEEVR+LYLEWR+K+ P + LD + R E+FK+NL +VD+HNA Sbjct: 42 RSDEEVRMLYLEWRAKNHPAEKYLDLNEYRLEVFKENLQFVDKHNA 87 >gb|AAW34137.1| cysteine protease gp3b [Zingiber officinale] Length = 466 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSDEEVR++Y EWR+KHRP +N R E+FK+NL +VDEHNA Sbjct: 34 RSDEEVRIIYQEWRAKHRPAENDQYVGDYRLEVFKENLRFVDEHNA 79 >gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale] Length = 475 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSDEEVR++Y EWR KHRP +N R E+FK+NL +VDEHNA Sbjct: 43 RSDEEVRIIYQEWRVKHRPAENDQYVGDYRLEVFKENLRFVDEHNA 88 >gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii] Length = 463 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNL Y+D+HNA Sbjct: 34 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 79 >gb|EMS56635.1| Oryzain alpha chain [Triticum urartu] Length = 483 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNL Y+D+HNA Sbjct: 32 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 77 >dbj|BAF02546.1| triticain alpha [Triticum aestivum] gi|388890585|gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum durum] Length = 461 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNL Y+D+HNA Sbjct: 32 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 77 >gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] Length = 469 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSD+EV LY W+++H NALD D R EIF+DNL ++D+HNA Sbjct: 38 RSDDEVHRLYQAWKAQHARSYNALDEDEQRLEIFRDNLRFIDQHNA 83 >ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi|355492134|gb|AES73337.1| Cysteine proteinase [Medicago truncatula] Length = 474 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFD--GDRFEIFKDNLLYVDEHNA 203 RSD+EV+ +Y EWR KH L N +D RFEIFKDNL ++DEHNA Sbjct: 44 RSDKEVKNIYEEWRVKHGKLNNNIDGSEKDKRFEIFKDNLKFIDEHNA 91 >gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus notabilis] Length = 361 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSD EVR +Y++W + H N L + RFEIFKDNL +VDEHNA Sbjct: 23 RSDAEVREMYVKWMATHGRAHNGLGEEETRFEIFKDNLRFVDEHNA 68 >dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 289 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNL Y+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 436 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNL Y+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare] gi|326513690|dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326514532|dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 463 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNL Y+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >gb|AFK47737.1| unknown [Medicago truncatula] Length = 359 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEV +Y EW KH + N L RFEIFKDNL ++DEHNA Sbjct: 26 RSNEEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEHNA 71 >ref|XP_003580684.1| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon] Length = 456 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EEVR +Y+EW +++ NA+ + RFE+F+DNL YVD+HNA Sbjct: 33 RSEEEVRRMYVEWMAENGRTYNAIGEEERRFEVFRDNLRYVDQHNA 78 >gb|ABR19827.1| cysteine proteinase [Elaeis guineensis] Length = 470 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EE+R+LY W +KH NAL RFEIFKDN+L++D HNA Sbjct: 41 RSEEEMRILYEGWLAKHGRAYNALGEKERRFEIFKDNVLFIDAHNA 86 >ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum] Length = 471 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 R+D+EV LY W +H+ + NAL RF+IFKDNL Y+DEHNA Sbjct: 45 RTDDEVMSLYESWLVEHKKVYNALGEKDKRFQIFKDNLKYIDEHNA 90 >gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris] Length = 373 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RSDEEVR +Y EW KH + + L RF+IFKDNL ++D+HNA Sbjct: 44 RSDEEVRSIYEEWLVKHGKVPSTLALKEKRFQIFKDNLKFIDDHNA 89 >gb|AFO83613.1| papain-like cysteine protease [Fagopyrum esculentum] Length = 362 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHNA 203 RS+EE R LY W +KHR NA+ + RFEIFKDNL ++DEHN+ Sbjct: 26 RSEEESRGLYQLWLAKHRKSYNAIGENEKRFEIFKDNLKFIDEHNS 71 >gb|EPS71857.1| senescence-associated cysteine protease, partial [Genlisea aurea] Length = 326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLLYVDEHN 200 RSD+EV+ LY EW +KH + NA+ RF+IFKDNL ++D+HN Sbjct: 1 RSDKEVKNLYEEWAAKHGKVYNAIGEKDKRFDIFKDNLKFIDDHN 45