BLASTX nr result
ID: Zingiber24_contig00025660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00025660 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141202.1| PREDICTED: lysosomal beta glucosidase-like [... 57 3e-06 >ref|XP_004141202.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus] Length = 566 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 123 ILIIAYWRTVVLAEYLKYKDPKQPLNVRIEDLLGRM 230 +L++ + T+ AEYLKYKDPKQPLNVRI+DLLGRM Sbjct: 12 LLVLCFSETLAKAEYLKYKDPKQPLNVRIKDLLGRM 47