BLASTX nr result
ID: Zingiber24_contig00025481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00025481 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845387.1| hypothetical protein AMTR_s00019p00053160 [A... 58 1e-06 ref|XP_004138697.1| PREDICTED: enhancer of rudimentary homolog [... 55 7e-06 >ref|XP_006845387.1| hypothetical protein AMTR_s00019p00053160 [Amborella trichopoda] gi|548847959|gb|ERN07062.1| hypothetical protein AMTR_s00019p00053160 [Amborella trichopoda] Length = 127 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 375 FEHSIQAYLPYDRVWIKNRMFHHLKKLASH 286 F+HSIQAYLPYDR WIK R F HLKKLASH Sbjct: 98 FDHSIQAYLPYDRQWIKQRTFQHLKKLASH 127 >ref|XP_004138697.1| PREDICTED: enhancer of rudimentary homolog [Cucumis sativus] gi|449493309|ref|XP_004159251.1| PREDICTED: enhancer of rudimentary homolog [Cucumis sativus] Length = 102 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 375 FEHSIQAYLPYDRVWIKNRMFHHLKKLA 292 FEHSIQAYLPYDR WIK R+F HLKKLA Sbjct: 74 FEHSIQAYLPYDRQWIKQRIFQHLKKLA 101