BLASTX nr result
ID: Zingiber24_contig00025080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00025080 (610 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA05215.1| cyclin-dependent kinase inhibitor protein [Oxyba... 56 9e-06 >emb|CAA05215.1| cyclin-dependent kinase inhibitor protein [Oxybasis rubra] Length = 196 Score = 55.8 bits (133), Expect = 9e-06 Identities = 19/34 (55%), Positives = 31/34 (91%) Frame = +1 Query: 4 AERNLRQRFAERYNFDVVNDVPMAGRFEWIPLTP 105 AE++L++RF+E+YNFD+V DVP+ GR++W+P+ P Sbjct: 163 AEKDLQKRFSEKYNFDIVKDVPLKGRYDWVPINP 196