BLASTX nr result
ID: Zingiber24_contig00024647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00024647 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|A9NNH7.1|LIAS_PICSI RecName: Full=Lipoyl synthase, mitochondr... 68 1e-09 ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citr... 67 2e-09 ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citr... 67 2e-09 ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-li... 67 2e-09 ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-li... 67 2e-09 ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-li... 67 2e-09 ref|XP_004245423.1| PREDICTED: lipoyl synthase 1, mitochondrial-... 67 2e-09 sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondr... 67 3e-09 emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group] 67 3e-09 ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group] g... 67 3e-09 ref|XP_006841751.1| hypothetical protein AMTR_s00003p00261780 [A... 66 4e-09 gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobro... 66 4e-09 gb|EMJ16732.1| hypothetical protein PRUPE_ppa007143mg [Prunus pe... 66 4e-09 ref|XP_003581304.1| PREDICTED: lipoyl synthase, mitochondrial-li... 66 4e-09 gb|EXB62277.1| Lipoyl synthase [Morus notabilis] 66 5e-09 ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-... 66 5e-09 ref|XP_004136815.1| PREDICTED: lipoyl synthase, mitochondrial-li... 66 5e-09 gb|AFK36952.1| unknown [Lotus japonicus] 66 5e-09 ref|XP_002447950.1| hypothetical protein SORBIDRAFT_06g018660 [S... 66 5e-09 gb|ESW21463.1| hypothetical protein PHAVU_005G072800g [Phaseolus... 65 7e-09 >sp|A9NNH7.1|LIAS_PICSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|116781644|gb|ABK22188.1| unknown [Picea sitchensis] Length = 386 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSAS 112 GFRYVASGPMVRSSYKAGEFYIKSMIE DR K SS+S Sbjct: 349 GFRYVASGPMVRSSYKAGEFYIKSMIEDDRKKASSSS 385 >ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|568877192|ref|XP_006491631.1| PREDICTED: lipoyl synthase, mitochondrial-like [Citrus sinensis] gi|557549932|gb|ESR60561.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 376 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA SS Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAATSS 376 >ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|557549931|gb|ESR60560.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 363 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA SS Sbjct: 329 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAATSS 363 >ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Oryza brachyantha] Length = 319 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSASN 115 GFRYVASGPMVRSSYKAGEFYIK+MIE+DRAK ++A + Sbjct: 280 GFRYVASGPMVRSSYKAGEFYIKAMIEADRAKTATAES 317 >ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-like [Solanum tuberosum] Length = 380 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA SS Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 380 >ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-like [Setaria italica] Length = 385 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSA 109 GFRYVASGPMVRSSYKAGEFYIK+MIE+DRAK S A Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKAMIEADRAKTSPA 381 >ref|XP_004245423.1| PREDICTED: lipoyl synthase 1, mitochondrial-like [Solanum lycopersicum] Length = 313 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA SS Sbjct: 279 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 313 >sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor Length = 382 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSA 109 GFRYVASGPMVRSSYKAGEFYIK+MIE+DRAK ++A Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKAMIEADRAKATTA 381 >emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group] Length = 382 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSA 109 GFRYVASGPMVRSSYKAGEFYIK+MIE+DRAK ++A Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKAMIEADRAKATTA 381 >ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group] gi|75144105|sp|Q7XRF1.2|LIAS_ORYSJ RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|38347101|emb|CAE02573.2| OSJNBa0006M15.16 [Oryza sativa Japonica Group] gi|113564535|dbj|BAF14878.1| Os04g0455800 [Oryza sativa Japonica Group] gi|125590593|gb|EAZ30943.1| hypothetical protein OsJ_15022 [Oryza sativa Japonica Group] gi|215767881|dbj|BAH00110.1| unnamed protein product [Oryza sativa Japonica Group] Length = 382 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSA 109 GFRYVASGPMVRSSYKAGEFYIK+MIE+DRAK ++A Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKAMIEADRAKATTA 381 >ref|XP_006841751.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda] gi|548843772|gb|ERN03426.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda] Length = 324 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSASN 115 GFRYVASGPMVRSSYKAGE YIKSMIESDRAK + S+ Sbjct: 285 GFRYVASGPMVRSSYKAGELYIKSMIESDRAKYRTVSS 322 >gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] Length = 376 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA +S Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAAAAS 376 >gb|EMJ16732.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica] Length = 380 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSAS 112 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA S S Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDRATSSHLS 378 >ref|XP_003581304.1| PREDICTED: lipoyl synthase, mitochondrial-like [Brachypodium distachyon] Length = 470 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSASNDGS 124 GFRYVASGPMVRSSYKAGEFYIK+MIE DRAK + ++ S Sbjct: 430 GFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKSGAVADSSS 470 >gb|EXB62277.1| Lipoyl synthase [Morus notabilis] Length = 384 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDR+ SS Sbjct: 346 GFRYVASGPMVRSSYKAGEFYIKSMIESDRSASSS 380 >ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Cicer arietinum] Length = 380 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMI+SDRA SS Sbjct: 341 GFRYVASGPMVRSSYKAGEFYIKSMIDSDRAASSS 375 >ref|XP_004136815.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus] gi|449479016|ref|XP_004155481.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus] Length = 381 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA +S Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAASNS 376 >gb|AFK36952.1| unknown [Lotus japonicus] Length = 116 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISS 106 GFRYVASGPMVRSSYKAGEFYIKSMI+SDRA SS Sbjct: 77 GFRYVASGPMVRSSYKAGEFYIKSMIDSDRAASSS 111 >ref|XP_002447950.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor] gi|308191440|sp|C5Y9R0.1|LIAS_SORBI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|241939133|gb|EES12278.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor] Length = 386 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSASN 115 GFRYVASGPMVRSSYKAGEFYIK+MIE+DR+K ++A + Sbjct: 347 GFRYVASGPMVRSSYKAGEFYIKAMIEADRSKATTADS 384 >gb|ESW21463.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris] Length = 377 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 2 GFRYVASGPMVRSSYKAGEFYIKSMIESDRAKISSASN 115 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA +S SN Sbjct: 342 GFRYVASGPMVRSSYKAGEFYIKSMIESDRA--ASPSN 377