BLASTX nr result
ID: Zingiber24_contig00024306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00024306 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001151395.1| phytosulfokines 2 precursor [Zea mays] gi|19... 55 7e-06 >ref|NP_001151395.1| phytosulfokines 2 precursor [Zea mays] gi|195646430|gb|ACG42683.1| phytosulfokines 2 precursor [Zea mays] Length = 138 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -1 Query: 250 SE*TGVLPSAQCTEGCKDGNEECLDRRVMYEAHLDYIYTQHRPKP 116 SE TG A TEG D EECL RR++ +AHLDYIYTQH+ KP Sbjct: 94 SETTGAEEEACGTEGDDDDEEECLQRRLLGDAHLDYIYTQHKGKP 138