BLASTX nr result
ID: Zingiber24_contig00023639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00023639 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531970.1| PREDICTED: uncharacterized protein At5g65660... 56 4e-06 gb|EOX91849.1| Hydroxyproline-rich glycoprotein family protein [... 55 7e-06 >ref|XP_003531970.1| PREDICTED: uncharacterized protein At5g65660-like [Glycine max] Length = 133 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -2 Query: 307 QENKEEKVRSLPVIMPGDKVPKFMAWPCPCQHSSP 203 +E+KE + +SLPV+MPGD+VPKF+A PCPCQ S P Sbjct: 74 KESKENRGQSLPVLMPGDEVPKFIAMPCPCQPSRP 108 >gb|EOX91849.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao] Length = 131 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -2 Query: 328 SKLAPDPQENKEEKVRSLPVIMPGDKVPKFMAWPCPCQHSSP 203 SK P+ + KE + +SLPV+MPGD++PKF+A+PCPC+ P Sbjct: 69 SKSKPEYMDLKENQSQSLPVLMPGDQIPKFIAFPCPCEPPGP 110