BLASTX nr result
ID: Zingiber24_contig00023399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00023399 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297868.1| hypothetical protein POPTR_0001s13210g [Popu... 58 1e-06 gb|EOX99667.1| RING finger protein, putative [Theobroma cacao] 55 7e-06 >ref|XP_002297868.1| hypothetical protein POPTR_0001s13210g [Populus trichocarpa] gi|222845126|gb|EEE82673.1| hypothetical protein POPTR_0001s13210g [Populus trichocarpa] Length = 62 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/60 (48%), Positives = 38/60 (63%) Frame = +3 Query: 3 SLRYEQAI*LVEITCRDQQLHPLSTLQYVRNTIWCSGNSMIMTPNSPAIDHVMTLQYRRS 182 S R++ I +EITCR QQL P TLQ+VR+ IW +++ + P S DHVM L Y RS Sbjct: 3 SSRFDYLI-YIEITCRGQQLVPFLTLQHVRDNIWSPRDALTLLPESSTTDHVMVLHYGRS 61 >gb|EOX99667.1| RING finger protein, putative [Theobroma cacao] Length = 342 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = +3 Query: 33 VEITCRDQQLHPLSTLQYVRNTIWCSGNSMIMTPNSPAIDHVMTLQYRRS 182 +EITCR QQL P TLQ VR+ IW S +++ + P + DHVM L Y RS Sbjct: 292 IEITCRGQQLVPYLTLQNVRDQIWSSRDAVTLLPETSTADHVMVLHYGRS 341