BLASTX nr result
ID: Zingiber24_contig00023375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00023375 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006416461.1| hypothetical protein EUTSA_v10009412mg [Eutr... 57 2e-06 ref|XP_006304311.1| hypothetical protein CARUB_v10010680mg [Caps... 55 7e-06 ref|NP_173411.1| SAUR-like auxin-responsive protein [Arabidopsis... 55 7e-06 >ref|XP_006416461.1| hypothetical protein EUTSA_v10009412mg [Eutrema salsugineum] gi|557094232|gb|ESQ34814.1| hypothetical protein EUTSA_v10009412mg [Eutrema salsugineum] Length = 117 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 279 AEEEFGFDHEQGLTIPCEEVAFRTLITAALR*T 181 AEEEFGFDH+ GLTIPCEEVAF++L+T+ LR T Sbjct: 83 AEEEFGFDHDMGLTIPCEEVAFKSLVTSMLRST 115 >ref|XP_006304311.1| hypothetical protein CARUB_v10010680mg [Capsella rubella] gi|482573022|gb|EOA37209.1| hypothetical protein CARUB_v10010680mg [Capsella rubella] Length = 118 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 279 AEEEFGFDHEQGLTIPCEEVAFRTLITAALR*T 181 AEEEFGFDH GLTIPCEEVAF++LIT+ L+ T Sbjct: 84 AEEEFGFDHNMGLTIPCEEVAFKSLITSMLQST 116 >ref|NP_173411.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] gi|10086504|gb|AAG12564.1|AC007797_24 Similar to auxin-induced proteins [Arabidopsis thaliana] gi|26450872|dbj|BAC42543.1| unknown protein [Arabidopsis thaliana] gi|28416847|gb|AAO42954.1| At1g19830 [Arabidopsis thaliana] gi|332191781|gb|AEE29902.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] Length = 117 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 279 AEEEFGFDHEQGLTIPCEEVAFRTLITAALR*T 181 AEEEFGFDH GLTIPCEEVAF++LIT+ L+ T Sbjct: 83 AEEEFGFDHNMGLTIPCEEVAFKSLITSMLQPT 115