BLASTX nr result
ID: Zingiber24_contig00021687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00021687 (267 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521005.1| Inhibitor of trypsin and hageman factor, put... 60 2e-07 sp|P24076.1|BGIA_MOMCH RecName: Full=Glu S.griseus protease inhi... 60 4e-07 gb|EMJ02675.1| hypothetical protein PRUPE_ppa014449mg [Prunus pe... 59 5e-07 ref|XP_002334124.1| predicted protein [Populus trichocarpa] gi|5... 59 7e-07 pdb|1VBW|A Chain A, Crystal Structure Of Bitter Gourd Trypsin In... 58 1e-06 dbj|BAB32588.1| inhibitor against trypsin [Momordica charantia] 58 1e-06 ref|XP_006495465.1| PREDICTED: inhibitor of trypsin and hageman ... 58 2e-06 ref|XP_006442409.1| hypothetical protein CICLE_v10022906mg [Citr... 58 2e-06 ref|XP_004134089.1| PREDICTED: inhibitor of trypsin and hageman ... 57 2e-06 gb|EXB81310.1| Proteinase inhibitor [Morus notabilis] 57 3e-06 ref|XP_006442402.1| hypothetical protein CICLE_v10022909mg [Citr... 57 3e-06 gb|EXB81311.1| Proteinase inhibitor [Morus notabilis] 57 3e-06 ref|XP_006377750.1| hypothetical protein POPTR_0011s11170g, part... 57 3e-06 gb|EMJ22563.1| hypothetical protein PRUPE_ppa018589mg [Prunus pe... 57 3e-06 ref|XP_003556368.1| PREDICTED: glu S.griseus protease inhibitor ... 57 3e-06 ref|XP_002334836.1| predicted protein [Populus trichocarpa] 57 3e-06 ref|XP_002317460.1| hypothetical protein POPTR_0011s11140g [Popu... 57 3e-06 ref|XP_002316860.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 gb|EOX94537.1| Inhibitor of trypsin and hageman factor [Theobrom... 56 6e-06 gb|EXB55550.1| Glu S.griseus protease inhibitor [Morus notabilis... 55 7e-06 >ref|XP_002521005.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis] gi|223539842|gb|EEF41422.1| Inhibitor of trypsin and hageman factor, putative [Ricinus communis] Length = 72 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A V G T DFRCDRVRVWVD+YGIV +VPHIG Sbjct: 32 NPKVGATIVKEGMMVTMDFRCDRVRVWVDKYGIVKDVPHIG 72 >sp|P24076.1|BGIA_MOMCH RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA gi|234607|gb|AAB19651.1| BGIA=acidic amino acid-specific endopeptidase inhibitor [Momordica charantia L.=bitter gourd, Peptide, 68 aa] Length = 68 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A+ V +GSP T DFRCDRVRVWV E GIV P IG Sbjct: 28 NPRVRAVIVRVGSPVTADFRCDRVRVWVTERGIVARPPAIG 68 >gb|EMJ02675.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica] Length = 69 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 N NV AI +L GSP TKD RCDRVRVW++ G+V PH+G Sbjct: 29 NHNVRAIVILEGSPATKDLRCDRVRVWINRNGVVVRPPHVG 69 >ref|XP_002334124.1| predicted protein [Populus trichocarpa] gi|566189803|ref|XP_002315724.2| trypsin inhibitor family protein [Populus trichocarpa] gi|566254881|ref|XP_006387617.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa] gi|550307858|gb|ERP46531.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa] gi|550329383|gb|EEF01895.2| trypsin inhibitor family protein [Populus trichocarpa] Length = 72 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP VEAI VL GS + DFRCDRV VWVDE GIV EVP IG Sbjct: 32 NPLVEAIIVLDGSEVSLDFRCDRVWVWVDERGIVIEVPRIG 72 >pdb|1VBW|A Chain A, Crystal Structure Of Bitter Gourd Trypsin Inhibitor gi|1096161|prf||2111250B trypsin inhibitor BGIT Length = 68 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A+ + +GS TKDFRCDRVRVWV E GIV P IG Sbjct: 28 NPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVARPPTIG 68 >dbj|BAB32588.1| inhibitor against trypsin [Momordica charantia] Length = 66 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A+ + +GS TKDFRCDRVRVWV E GIV P IG Sbjct: 26 NPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVARPPTIG 66 >ref|XP_006495465.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus sinensis] Length = 119 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NPNV AI +L G+P T+DFRCDRVRV VD+Y V +VP IG Sbjct: 79 NPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQVPRIG 119 >ref|XP_006442409.1| hypothetical protein CICLE_v10022906mg [Citrus clementina] gi|557544671|gb|ESR55649.1| hypothetical protein CICLE_v10022906mg [Citrus clementina] Length = 119 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NPNV AI +L G+P T+DFRCDRVRV VD+Y V +VP IG Sbjct: 79 NPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQVPRIG 119 >ref|XP_004134089.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis sativus] gi|449516591|ref|XP_004165330.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis sativus] Length = 69 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NPNV A+ + +G+P TKDFRC+RVRVWV + G+V P +G Sbjct: 29 NPNVRAVVLEVGTPVTKDFRCNRVRVWVKKNGLVASPPMVG 69 >gb|EXB81310.1| Proteinase inhibitor [Morus notabilis] Length = 71 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NPNV+AI L G+P +D+RC+RV +WV+ +G+V VPH+G Sbjct: 31 NPNVDAIVKLQGTPVIQDYRCNRVWIWVNTHGVVSTVPHVG 71 >ref|XP_006442402.1| hypothetical protein CICLE_v10022909mg [Citrus clementina] gi|557544664|gb|ESR55642.1| hypothetical protein CICLE_v10022909mg [Citrus clementina] Length = 119 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NPNV AI +L G+P T DFRCDRVRV VD+Y V +VP IG Sbjct: 79 NPNVHAIIILKGTPVTPDFRCDRVRVVVDKYEKVVQVPRIG 119 >gb|EXB81311.1| Proteinase inhibitor [Morus notabilis] Length = 130 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 N NV+A +L G+ TKDFRCDRV VWV+ YG V EVP +G Sbjct: 30 NKNVDAKVILEGTAVTKDFRCDRVWVWVNNYGTVTEVPRVG 70 >ref|XP_006377750.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa] gi|566253262|ref|XP_006387186.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa] gi|550305579|gb|ERP46100.1| hypothetical protein POPTR_1585s00210g, partial [Populus trichocarpa] gi|550328150|gb|ERP55547.1| hypothetical protein POPTR_0011s11170g, partial [Populus trichocarpa] Length = 65 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A V G T DFRCDRVRVWVD+YGIV ++P IG Sbjct: 25 NPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDIPQIG 65 >gb|EMJ22563.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica] Length = 70 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 N +V+A VL G+P T+DFRCDRVRVWVD GIV VP IG Sbjct: 30 NSSVDAQIVLEGTPVTRDFRCDRVRVWVDTDGIVIRVPSIG 70 >ref|XP_003556368.1| PREDICTED: glu S.griseus protease inhibitor [Glycine max] gi|255631802|gb|ACU16268.1| unknown [Glycine max] Length = 70 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V+A TVL GS T DFRCDRVRVWV ++GIV + P IG Sbjct: 30 NPLVDANTVLKGSIVTADFRCDRVRVWVTKHGIVYQAPRIG 70 >ref|XP_002334836.1| predicted protein [Populus trichocarpa] Length = 80 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A V G T DFRCDRVRVWVD+YGIV ++P IG Sbjct: 40 NPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDIPQIG 80 >ref|XP_002317460.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa] gi|222860525|gb|EEE98072.1| hypothetical protein POPTR_0011s11140g [Populus trichocarpa] Length = 72 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A V G T DFRCDRVRVWVD+YGIV ++P IG Sbjct: 32 NPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDIPQIG 72 >ref|XP_002316860.1| predicted protein [Populus trichocarpa] gi|224117040|ref|XP_002317459.1| predicted protein [Populus trichocarpa] Length = 66 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A V G T DFRCDRVRVWVD+YGIV ++P IG Sbjct: 26 NPKVRAGIVKEGMMVTMDFRCDRVRVWVDKYGIVKDIPQIG 66 >gb|EOX94537.1| Inhibitor of trypsin and hageman factor [Theobroma cacao] Length = 69 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V A+ V G T DFRCDRVRVWVD+YGIV P IG Sbjct: 29 NPKVGAVIVKEGMMVTMDFRCDRVRVWVDKYGIVKRKPQIG 69 >gb|EXB55550.1| Glu S.griseus protease inhibitor [Morus notabilis] gi|587866051|gb|EXB55551.1| Glu S.griseus protease inhibitor [Morus notabilis] Length = 70 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 3 NPNVEAITVLIGSPTTKDFRCDRVRVWVDEYGIVGEVPHIG 125 NP V+AI V GS T D+RCDRVRVWV+ +GIV +VP IG Sbjct: 30 NPAVDAIIVTEGSVVTADYRCDRVRVWVNNHGIVYKVPTIG 70