BLASTX nr result
ID: Zingiber24_contig00021138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00021138 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY32402.1| Metal tolerance protein 4 isoform 1 [Theobroma ca... 57 3e-06 >gb|EOY32402.1| Metal tolerance protein 4 isoform 1 [Theobroma cacao] gi|508785147|gb|EOY32403.1| Metal tolerance protein 4 isoform 1 [Theobroma cacao] gi|508785148|gb|EOY32404.1| Metal tolerance protein 4 isoform 1 [Theobroma cacao] gi|508785149|gb|EOY32405.1| Metal tolerance protein 4 isoform 1 [Theobroma cacao] Length = 407 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = +2 Query: 113 MEG--GENDRAAAEVRTPLLGPAGRMPRKNSVTSMRGEFVSRLPDKVRRGVDLERPF 277 MEG G D+ A +++ G GR R+NSV S+R EFVSRLPDKVR GVD E PF Sbjct: 1 MEGELGSGDKTALLMKSGS-GKRGRFYRRNSVNSLRNEFVSRLPDKVRSGVDAESPF 56