BLASTX nr result
ID: Zingiber24_contig00021053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00021053 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW59506.1| hypothetical protein ZEAMMB73_345687 [Zea mays] 60 2e-07 gb|ACG47877.1| hypothetical protein [Zea mays] 60 2e-07 tpg|DAA35958.1| TPA: hypothetical protein ZEAMMB73_880622 [Zea m... 57 3e-06 >gb|AFW59506.1| hypothetical protein ZEAMMB73_345687 [Zea mays] Length = 55 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 216 MNWFVNLGLNSNSSHFVTCLLFFILHYSPQLAPSILN 106 MN FVNLGLNSNS+H+V CLL F+LH+SPQL PS N Sbjct: 1 MNCFVNLGLNSNSNHYVACLLIFLLHFSPQLNPSNSN 37 >gb|ACG47877.1| hypothetical protein [Zea mays] Length = 57 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 216 MNWFVNLGLNSNSSHFVTCLLFFILHYSPQLAPSILN 106 MN FVNLGLNSNS+H+V CLL F+LH+SPQL PS N Sbjct: 1 MNCFVNLGLNSNSNHYVACLLIFLLHFSPQLNPSNSN 37 >tpg|DAA35958.1| TPA: hypothetical protein ZEAMMB73_880622 [Zea mays] Length = 56 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 216 MNWFVNLGLNSNSSHFVTCLLFFILHYSPQL 124 MN FVNLGLNSNS+H+V CLL F+LH+SPQL Sbjct: 1 MNCFVNLGLNSNSNHYVACLLIFLLHFSPQL 31