BLASTX nr result
ID: Zingiber24_contig00020933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00020933 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277964.1| PREDICTED: uncharacterized protein LOC100250... 55 7e-06 emb|CAN63851.1| hypothetical protein VITISV_016796 [Vitis vinifera] 55 7e-06 ref|XP_002527671.1| protein with unknown function [Ricinus commu... 55 1e-05 ref|XP_002326528.1| predicted protein [Populus trichocarpa] gi|5... 55 1e-05 gb|ABK96276.1| unknown [Populus trichocarpa x Populus deltoides] 55 1e-05 >ref|XP_002277964.1| PREDICTED: uncharacterized protein LOC100250554 [Vitis vinifera] gi|297742091|emb|CBI33878.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 PPPTAASCRSAKRRKGIPHRAPFGSLIVEYF 95 PPPTA + R+AKRRKGIPHRAP G LI+EY+ Sbjct: 232 PPPTAVNYRTAKRRKGIPHRAPMGGLIIEYY 262 >emb|CAN63851.1| hypothetical protein VITISV_016796 [Vitis vinifera] Length = 244 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 PPPTAASCRSAKRRKGIPHRAPFGSLIVEYF 95 PPPTA + R+AKRRKGIPHRAP G LI+EY+ Sbjct: 214 PPPTAVNYRTAKRRKGIPHRAPMGGLIIEYY 244 >ref|XP_002527671.1| protein with unknown function [Ricinus communis] gi|223532976|gb|EEF34742.1| protein with unknown function [Ricinus communis] Length = 223 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 PPPTAASCRSAKRRKGIPHRAPFGSLIVEYF 95 PPPT+ S RSAKRRKGIPHRAP G LI+E++ Sbjct: 193 PPPTSVSYRSAKRRKGIPHRAPMGGLIIEFY 223 >ref|XP_002326528.1| predicted protein [Populus trichocarpa] gi|566146777|ref|XP_006368393.1| zinc-binding family protein [Populus trichocarpa] gi|550346306|gb|ERP64962.1| zinc-binding family protein [Populus trichocarpa] Length = 231 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 PPPTAASCRSAKRRKGIPHRAPFGSLIVEY 92 PPPT AS R+AKRRKGIPHRAP G LI+EY Sbjct: 202 PPPTPASYRTAKRRKGIPHRAPMGGLIIEY 231 >gb|ABK96276.1| unknown [Populus trichocarpa x Populus deltoides] Length = 231 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 PPPTAASCRSAKRRKGIPHRAPFGSLIVEY 92 PPPT AS R+AKRRKGIPHRAP G LI+EY Sbjct: 202 PPPTPASYRTAKRRKGIPHRAPMGGLIIEY 231