BLASTX nr result
ID: Zingiber24_contig00020379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00020379 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63911.1| Bowman-Birk serine proteinase inhibitor [Musa acu... 106 4e-21 ref|NP_001183663.1| uncharacterized protein LOC100502257 precurs... 85 9e-15 ref|XP_002463618.1| hypothetical protein SORBIDRAFT_01g003000 [S... 82 1e-13 ref|XP_004981231.1| PREDICTED: Bowman-Birk type trypsin inhibito... 80 2e-13 ref|NP_001051742.1| Os03g0823400 [Oryza sativa Japonica Group] g... 80 4e-13 gb|EEC76433.1| hypothetical protein OsI_14121 [Oryza sativa Indi... 80 4e-13 dbj|BAJ91965.1| predicted protein [Hordeum vulgare subsp. vulgare] 79 6e-13 dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] 79 6e-13 ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibito... 79 8e-13 tpg|DAA52234.1| TPA: hypothetical protein ZEAMMB73_473044 [Zea m... 77 2e-12 dbj|BAJ86432.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 1e-11 ref|XP_002458758.1| hypothetical protein SORBIDRAFT_03g039790 [S... 69 8e-10 gb|AFW58346.1| hypothetical protein ZEAMMB73_607704 [Zea mays] 67 2e-09 ref|XP_004970570.1| PREDICTED: Bowman-Birk type trypsin inhibito... 67 3e-09 ref|XP_004986446.1| PREDICTED: Bowman-Birk type trypsin inhibito... 62 6e-08 tpg|DAA56839.1| TPA: bowman-Birk type trypsin inhibitor [Zea mays] 62 6e-08 ref|NP_001148299.1| Bowman-Birk type trypsin inhibitor precursor... 62 6e-08 ref|XP_002458759.1| hypothetical protein SORBIDRAFT_03g039800 [S... 62 1e-07 gb|AFW74537.1| hypothetical protein ZEAMMB73_273786 [Zea mays] 59 7e-07 ref|XP_004986447.1| PREDICTED: Bowman-Birk type trypsin inhibito... 58 1e-06 >gb|ABL63911.1| Bowman-Birk serine proteinase inhibitor [Musa acuminata AAA Group] Length = 126 Score = 106 bits (264), Expect = 4e-21 Identities = 46/69 (66%), Positives = 50/69 (72%) Frame = -2 Query: 209 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRRCHPSCRSCVRSPLSVEP 30 E G + R RRTWPCCDRCGGC T S P+CQC D+VR CHPSCR CVRSPLSV P Sbjct: 43 EEDGEGVGERSRQRRTWPCCDRCGGC-TKSTPPQCQCQDMVRSCHPSCRHCVRSPLSVSP 101 Query: 29 PLFYCSDRI 3 PL+ C DRI Sbjct: 102 PLYQCMDRI 110 >ref|NP_001183663.1| uncharacterized protein LOC100502257 precursor [Zea mays] gi|238013754|gb|ACR37912.1| unknown [Zea mays] gi|413932571|gb|AFW67122.1| hypothetical protein ZEAMMB73_326607 [Zea mays] Length = 201 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/67 (53%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 24 G A +A R WPCCD CGGC T S+ P CQC D R CHP+CR CV+S LS +PP+ Sbjct: 119 GELASRAKAAARAWPCCDSCGGC-TRSEPPRCQCLDAAPRGCHPACRDCVKSSLSADPPV 177 Query: 23 FYCSDRI 3 + C DR+ Sbjct: 178 YQCMDRV 184 >ref|XP_002463618.1| hypothetical protein SORBIDRAFT_01g003000 [Sorghum bicolor] gi|241917472|gb|EER90616.1| hypothetical protein SORBIDRAFT_01g003000 [Sorghum bicolor] Length = 93 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 24 G A + R WPCCD CGGC T S+ CQC D V R CHP+CR CV+S LS +PP+ Sbjct: 13 GELASRGKAAARAWPCCDSCGGC-TKSEPRRCQCLDAVPRGCHPACRDCVKSSLSADPPV 71 Query: 23 FYCSDRI 3 + C DR+ Sbjct: 72 YQCMDRV 78 >ref|XP_004981231.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 121 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 24 G A + R WPCCD CGGC T S P CQC D V R CHP+C+ C++S LS +PP+ Sbjct: 42 GELASRGKAAARAWPCCDNCGGC-TKSIPPLCQCLDAVPRGCHPACQDCIKSSLSADPPV 100 Query: 23 FYCSDRI 3 + C DR+ Sbjct: 101 YQCMDRV 107 >ref|NP_001051742.1| Os03g0823400 [Oryza sativa Japonica Group] gi|27545054|gb|AAO18460.1| putative Bowman-Birk serine protease inhibitor [Oryza sativa Japonica Group] gi|108711821|gb|ABF99616.1| Bowman-Birk serine protease inhibitor family protein, expressed [Oryza sativa Japonica Group] gi|113550213|dbj|BAF13656.1| Os03g0823400 [Oryza sativa Japonica Group] gi|222626071|gb|EEE60203.1| hypothetical protein OsJ_13170 [Oryza sativa Japonica Group] Length = 127 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/68 (55%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -2 Query: 203 KGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPP 27 KGAAA WPCCD CGGC T S P+CQC D CHP+C+SCV+S LSV PP Sbjct: 56 KGAAA--------AWPCCDNCGGC-TKSIPPQCQCMDARPAGCHPACKSCVKSSLSVSPP 106 Query: 26 LFYCSDRI 3 ++ C DRI Sbjct: 107 VYQCMDRI 114 >gb|EEC76433.1| hypothetical protein OsI_14121 [Oryza sativa Indica Group] Length = 128 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/68 (55%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -2 Query: 203 KGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPP 27 KGAAA WPCCD CGGC T S P+CQC D CHP+C+SCV+S LSV PP Sbjct: 57 KGAAA--------AWPCCDNCGGC-TKSIPPQCQCMDARPAGCHPACKSCVKSSLSVSPP 107 Query: 26 LFYCSDRI 3 ++ C DRI Sbjct: 108 VYQCMDRI 115 >dbj|BAJ91965.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 99 Score = 79.0 bits (193), Expect = 6e-13 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 161 WPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRI 3 WPCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+ Sbjct: 33 WPCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRV 85 >dbj|BAK01561.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 137 Score = 79.0 bits (193), Expect = 6e-13 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 161 WPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRI 3 WPCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+ Sbjct: 71 WPCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRV 123 >ref|XP_003563517.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Brachypodium distachyon] Length = 135 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 167 RTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRI 3 + WPCCD CGGC T S P CQC D CHP+C SCV+S LSV PP+++C DRI Sbjct: 65 KAWPCCDSCGGC-TKSIPPRCQCMDAAPGGCHPACESCVKSSLSVHPPVYHCMDRI 119 >tpg|DAA52234.1| TPA: hypothetical protein ZEAMMB73_473044 [Zea mays] Length = 127 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPL 24 G A + R WPCCD CGGC T S+ C+C D R CHP+CR CV+S LS +PP+ Sbjct: 46 GELASRGKAAARAWPCCDSCGGC-TRSEPRLCRCLDAAPRGCHPACRDCVKSSLSADPPV 104 Query: 23 FYCSDRI 3 + C DR+ Sbjct: 105 YQCMDRV 111 >dbj|BAJ86432.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 146 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -2 Query: 158 PCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLSVEPPLFYCSDRI 3 PCCD CGGC T SD+P+C+C D CHP+CR CV+S L+V PP++ C DR+ Sbjct: 81 PCCDSCGGC-TKSDSPQCRCMDAAPGGCHPACRDCVKSALAVHPPVYQCMDRV 132 >ref|XP_002458758.1| hypothetical protein SORBIDRAFT_03g039790 [Sorghum bicolor] gi|241930733|gb|EES03878.1| hypothetical protein SORBIDRAFT_03g039790 [Sorghum bicolor] Length = 105 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 3/71 (4%) Frame = -2 Query: 212 PELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVRSPLS- 39 P KG A R + +WPCCD+CG C S P CQC D +R CHP+CRSC++ Sbjct: 20 PLSKGEEEGGAARAKGSWPCCDKCGFCYR-SFPPRCQCLDFSQRGCHPACRSCLKFTTGG 78 Query: 38 -VEPPLFYCSD 9 EPP+F C+D Sbjct: 79 IDEPPIFRCAD 89 >gb|AFW58346.1| hypothetical protein ZEAMMB73_607704 [Zea mays] Length = 284 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVR-RCHPSCRSCVRSPLSVEPPL 24 G A +A R WPCCD CGGC T + P CQ D CHP+CR CV+S LS++PP+ Sbjct: 129 GELASRAKAAARAWPCCDSCGGC-TRPEPPWCQRLDAAPCGCHPACRDCVKSSLSIDPPI 187 >ref|XP_004970570.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 116 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 6/73 (8%) Frame = -2 Query: 209 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVR-----S 48 E +G AA R WPCCD+CG C P+C C D R CHP+CR CVR S Sbjct: 28 EEEGGAAFAMDTNARAWPCCDKCGLCLL-MYPPQCNCMDFSERGCHPACRKCVRYTADGS 86 Query: 47 PLSVEPPLFYCSD 9 +S EPP++ C+D Sbjct: 87 SISQEPPVYRCAD 99 >ref|XP_004986446.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 116 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 6/73 (8%) Frame = -2 Query: 209 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDLVRR-CHPSCRSCVR-----S 48 E +G AA R WPCCD+CG C P+C C D R CHP+CR CVR S Sbjct: 28 EEEGGAAFAMDTNARAWPCCDKCGLCLL-MYPPQCNCMDFSERGCHPACRKCVRYTADGS 86 Query: 47 PLSVEPPLFYCSD 9 +S EPP++ +D Sbjct: 87 SISQEPPVYRYAD 99 >tpg|DAA56839.1| TPA: bowman-Birk type trypsin inhibitor [Zea mays] Length = 108 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -2 Query: 170 RRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPLFYCSDRI 3 RR WPCCD+CG C T S P C+C D CHP+C++C LS+ LF C D+I Sbjct: 39 RRRWPCCDQCGIC-TRSQPPICECRDTSTTGCHPACKACA---LSISDGLFVCKDKI 91 >ref|NP_001148299.1| Bowman-Birk type trypsin inhibitor precursor [Zea mays] gi|195617250|gb|ACG30455.1| Bowman-Birk type trypsin inhibitor [Zea mays] Length = 107 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -2 Query: 170 RRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEPPLFYCSDRI 3 RR WPCCD+CG C T S P C+C D CHP+C++C LS+ LF C D+I Sbjct: 38 RRRWPCCDQCGIC-TRSQPPICECRDTSTTGCHPACKACA---LSISDGLFVCKDKI 90 >ref|XP_002458759.1| hypothetical protein SORBIDRAFT_03g039800 [Sorghum bicolor] gi|241930734|gb|EES03879.1| hypothetical protein SORBIDRAFT_03g039800 [Sorghum bicolor] Length = 112 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = -2 Query: 209 ELKGAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVE 33 E K AAAE R WPCCD CG C T S P CQC D C+P C++CV+ S+ Sbjct: 27 EEKEAAAEGVDARRWRWPCCDECGVC-TRSQPPICQCLDTSTSGCNPGCKACVK---SIS 82 Query: 32 PPLFYCSDRI 3 L+ C DRI Sbjct: 83 DGLYECKDRI 92 >gb|AFW74537.1| hypothetical protein ZEAMMB73_273786 [Zea mays] Length = 99 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -2 Query: 164 TWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLSVEP 30 +WPCCD CG C PECQC+D+ V CHP C++CV+ + P Sbjct: 25 SWPCCDNCGAC-NRKQPPECQCNDVSVNGCHPECKNCVKVGAGIRP 69 >ref|XP_004986447.1| PREDICTED: Bowman-Birk type trypsin inhibitor-like [Setaria italica] Length = 113 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/69 (46%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = -2 Query: 200 GAAAEQAIRVRRTWPCCDRCGGCATGSDAPECQCHDL-VRRCHPSCRSCVRSPLS--VEP 30 G AA R WPCCD CG C T S P C C DL CHP+CR+C++S Sbjct: 31 GGAAPGNDANARAWPCCDTCGVC-TRSLPPICSCRDLSPGGCHPACRNCLQSTTGGVRGA 89 Query: 29 PLFYCSDRI 3 PLF C+D I Sbjct: 90 PLFQCTDFI 98