BLASTX nr result
ID: Zingiber24_contig00020323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00020323 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538051.1| PREDICTED: protein transport protein Sec61 s... 89 6e-16 gb|ABG24204.1| putative transport protein [Gymnadenia conopsea] 87 2e-15 ref|XP_004487131.1| PREDICTED: protein transport protein Sec61 s... 86 7e-15 gb|ABK25751.1| unknown [Picea sitchensis] gi|116791539|gb|ABK260... 85 1e-14 gb|ESW04188.1| hypothetical protein PHAVU_011G073900g [Phaseolus... 84 1e-14 ref|XP_004505968.1| PREDICTED: protein transport protein Sec61 s... 84 1e-14 gb|ESW22212.1| hypothetical protein PHAVU_005G136600g [Phaseolus... 84 2e-14 ref|XP_003540170.1| PREDICTED: protein transport protein Sec61 s... 84 3e-14 gb|AFW74906.1| hypothetical protein ZEAMMB73_465064, partial [Ze... 83 3e-14 ref|XP_002440474.1| hypothetical protein SORBIDRAFT_09g001550 [S... 83 3e-14 ref|NP_001147265.1| protein transport protein Sec61 beta subunit... 83 3e-14 ref|XP_002276029.1| PREDICTED: protein transport protein Sec61 s... 83 3e-14 ref|NP_001152478.1| protein transport protein Sec61 beta subunit... 83 4e-14 ref|XP_004978424.1| PREDICTED: protein transport protein Sec61 s... 82 6e-14 ref|XP_004977636.1| PREDICTED: protein transport protein Sec61 s... 82 6e-14 ref|XP_003597194.1| Protein transport protein Sec61 beta subunit... 82 6e-14 ref|XP_003577895.1| PREDICTED: protein transport protein Sec61 s... 82 6e-14 emb|CBI16290.3| unnamed protein product [Vitis vinifera] 82 6e-14 ref|XP_002285035.1| PREDICTED: protein transport protein Sec61 s... 82 6e-14 ref|XP_003543483.1| PREDICTED: protein transport protein Sec61 s... 82 7e-14 >ref|XP_003538051.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform X1 [Glycine max] gi|571488766|ref|XP_006591027.1| PREDICTED: protein transport protein Sec61 subunit beta-like isoform X2 [Glycine max] Length = 107 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYRYRS+GA+ Sbjct: 62 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYRSSGAT 106 >gb|ABG24204.1| putative transport protein [Gymnadenia conopsea] Length = 107 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGA 313 FYTD+APGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRY+S G+ Sbjct: 64 FYTDDAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYKSGGS 107 >ref|XP_004487131.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Cicer arietinum] Length = 105 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAG 316 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYRY+S G Sbjct: 61 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYKSGG 103 >gb|ABK25751.1| unknown [Picea sitchensis] gi|116791539|gb|ABK26018.1| unknown [Picea sitchensis] gi|224286463|gb|ACN40938.1| unknown [Picea sitchensis] Length = 108 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGA 313 FYTD+APGLK++PTVVLVMSLCFIGFVTALHV GKLYRYRS GA Sbjct: 65 FYTDDAPGLKITPTVVLVMSLCFIGFVTALHVIGKLYRYRSGGA 108 >gb|ESW04188.1| hypothetical protein PHAVU_011G073900g [Phaseolus vulgaris] gi|561028457|gb|ESW27097.1| hypothetical protein PHAVU_003G173500g [Phaseolus vulgaris] Length = 106 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRS 322 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYRYRS Sbjct: 62 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYRS 102 >ref|XP_004505968.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Cicer arietinum] Length = 107 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSA 319 FYTD+APGLK+SPTVVLVMSLCFIGFVT LHVFGKLYRYRSA Sbjct: 63 FYTDDAPGLKISPTVVLVMSLCFIGFVTTLHVFGKLYRYRSA 104 >gb|ESW22212.1| hypothetical protein PHAVU_005G136600g [Phaseolus vulgaris] Length = 105 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYR +S GA+ Sbjct: 61 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGGAA 105 >ref|XP_003540170.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] Length = 105 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGA 313 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYR +S GA Sbjct: 61 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGGA 104 >gb|AFW74906.1| hypothetical protein ZEAMMB73_465064, partial [Zea mays] Length = 55 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALH+FGKLYR R+A AS Sbjct: 10 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHIFGKLYRSRTAAAS 54 >ref|XP_002440474.1| hypothetical protein SORBIDRAFT_09g001550 [Sorghum bicolor] gi|241945759|gb|EES18904.1| hypothetical protein SORBIDRAFT_09g001550 [Sorghum bicolor] Length = 107 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALH+FGKLYR R+A AS Sbjct: 62 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHIFGKLYRSRTAAAS 106 >ref|NP_001147265.1| protein transport protein Sec61 beta subunit [Zea mays] gi|195609254|gb|ACG26457.1| protein transport protein Sec61 beta subunit [Zea mays] gi|195627810|gb|ACG35735.1| protein transport protein Sec61 beta subunit [Zea mays] gi|413950193|gb|AFW82842.1| protein transport protein Sec61 beta subunit [Zea mays] Length = 107 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALH+FGKLYR R+A AS Sbjct: 62 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHIFGKLYRSRTAAAS 106 >ref|XP_002276029.1| PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] gi|147800942|emb|CAN75561.1| hypothetical protein VITISV_032577 [Vitis vinifera] Length = 108 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTD+APGLK++PTVVLVMSLCFIGFVTALHVFGK+YR+RS G + Sbjct: 64 FYTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKIYRHRSGGVA 108 >ref|NP_001152478.1| protein transport protein Sec61 beta subunit [Zea mays] gi|195656683|gb|ACG47809.1| protein transport protein Sec61 beta subunit [Zea mays] Length = 84 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALH+FGKLYR R A AS Sbjct: 39 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHIFGKLYRSRKAAAS 83 >ref|XP_004978424.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Setaria italica] Length = 107 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALHVFGKLYR R+A A+ Sbjct: 61 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAAAA 105 >ref|XP_004977636.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Setaria italica] Length = 108 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALHVFGKLYR R+A A+ Sbjct: 62 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAAAA 106 >ref|XP_003597194.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] gi|87241202|gb|ABD33060.1| Sec61beta [Medicago truncatula] gi|355486242|gb|AES67445.1| Protein transport protein Sec61 beta subunit [Medicago truncatula] Length = 107 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGA 313 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYRY+ AGA Sbjct: 63 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYK-AGA 105 >ref|XP_003577895.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Brachypodium distachyon] Length = 112 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAGAS 310 FYTDEAPGL++SPT+VLVMSLCFIGFVTALHVFGKLYR R+A +S Sbjct: 65 FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAASS 109 >emb|CBI16290.3| unnamed protein product [Vitis vinifera] Length = 699 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAG 316 FYTD+APGLK++PTVVLVMSLCFIGFVTALHVFGK+YRY++ G Sbjct: 655 FYTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKIYRYKAGG 697 >ref|XP_002285035.1| PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] Length = 107 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAG 316 FYTD+APGLK++PTVVLVMSLCFIGFVTALHVFGK+YRY++ G Sbjct: 63 FYTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKIYRYKAGG 105 >ref|XP_003543483.1| PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] Length = 105 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 444 FYTDEAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYRSAG 316 FYTD+APGLK+SPTVVLVMSLCFIGFVTALHVFGKLYR +S G Sbjct: 61 FYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGG 103