BLASTX nr result
ID: Zingiber24_contig00020264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00020264 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT27234.1| hypothetical protein F775_16403 [Aegilops tauschii] 55 7e-06 >gb|EMT27234.1| hypothetical protein F775_16403 [Aegilops tauschii] Length = 234 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -2 Query: 251 ADAETEVVALERLKAAEELMGGLTETGISERVFRSLMNARVSLLNILTP 105 A ET +VALERL+ EE +GGL ETG SE+VFR L+ +RVSLLNILTP Sbjct: 187 AAPETAMVALERLEKLEESIGGL-ETG-SEKVFRRLLQSRVSLLNILTP 233