BLASTX nr result
ID: Zingiber24_contig00019780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019780 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY10889.1| Ankyrin repeat family protein isoform 1 [Theobrom... 63 5e-08 ref|XP_002266715.2| PREDICTED: ankyrin repeat domain-containing ... 62 1e-07 ref|XP_006649154.1| PREDICTED: ankyrin repeat domain-containing ... 61 1e-07 ref|XP_004152818.1| PREDICTED: ankyrin repeat domain-containing ... 61 1e-07 dbj|BAD19146.1| ankyrin repeat protein-like [Oryza sativa Japoni... 61 1e-07 gb|AFW73970.1| hypothetical protein ZEAMMB73_861992 [Zea mays] 61 1e-07 ref|XP_002521987.1| protein binding protein, putative [Ricinus c... 61 1e-07 gb|EAZ25027.1| hypothetical protein OsJ_08814 [Oryza sativa Japo... 61 1e-07 gb|EAY87957.1| hypothetical protein OsI_09382 [Oryza sativa Indi... 61 1e-07 gb|EXB93157.1| Ankyrin repeat domain-containing protein 13B [Mor... 61 2e-07 gb|ACN27704.1| unknown [Zea mays] gi|413924113|gb|AFW64045.1| pr... 61 2e-07 gb|ACF87656.1| unknown [Zea mays] 61 2e-07 gb|EMT27115.1| hypothetical protein F775_09832 [Aegilops tauschii] 60 2e-07 ref|XP_003572930.1| PREDICTED: ankyrin repeat domain-containing ... 60 2e-07 ref|XP_002453012.1| hypothetical protein SORBIDRAFT_04g036710 [S... 60 2e-07 ref|XP_004142545.1| PREDICTED: ankyrin repeat domain-containing ... 60 4e-07 dbj|BAK00886.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 dbj|BAK03521.1| predicted protein [Hordeum vulgare subsp. vulgar... 60 4e-07 gb|EPS67902.1| hypothetical protein M569_06870, partial [Genlise... 59 5e-07 ref|XP_004954316.1| PREDICTED: ankyrin repeat domain-containing ... 59 9e-07 >gb|EOY10889.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508718993|gb|EOY10890.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] Length = 658 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+RGGQ+SDS + KDE+DPFHIPSDY+W+DANE Sbjct: 586 MRGSRGGQSSDS-DSHRYKDEVDPFHIPSDYTWVDANE 622 >ref|XP_002266715.2| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Vitis vinifera] Length = 660 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+RGGQ+SD E KD+IDPFHIPSDY+W+DANE Sbjct: 587 MRGSRGGQSSDG-ESHRYKDDIDPFHIPSDYTWVDANE 623 >ref|XP_006649154.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like, partial [Oryza brachyantha] Length = 559 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPF IPSDY+W+DANE Sbjct: 482 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 519 >ref|XP_004152818.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] gi|449477722|ref|XP_004155104.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] Length = 658 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+RGGQ+SDS + KDE+DPFHIPS+Y+W+DANE Sbjct: 587 MRGSRGGQSSDSDSNRY-KDEVDPFHIPSEYTWVDANE 623 >dbj|BAD19146.1| ankyrin repeat protein-like [Oryza sativa Japonica Group] Length = 633 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPF IPSDY+W+DANE Sbjct: 557 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 594 >gb|AFW73970.1| hypothetical protein ZEAMMB73_861992 [Zea mays] Length = 631 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 ++G RG Q+SDS + +S KDE+DPFHIPSDY+W+DA E Sbjct: 555 VKGGRGTQSSDSGDSRSWKDEVDPFHIPSDYTWVDATE 592 >ref|XP_002521987.1| protein binding protein, putative [Ricinus communis] gi|223538791|gb|EEF40391.1| protein binding protein, putative [Ricinus communis] Length = 661 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+ GGQ+SDS + KDEIDPFHIPSDY+W+DANE Sbjct: 588 MRGSNGGQSSDS-DSHRYKDEIDPFHIPSDYTWVDANE 624 >gb|EAZ25027.1| hypothetical protein OsJ_08814 [Oryza sativa Japonica Group] Length = 544 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPF IPSDY+W+DANE Sbjct: 470 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 507 >gb|EAY87957.1| hypothetical protein OsI_09382 [Oryza sativa Indica Group] Length = 634 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPF IPSDY+W+DANE Sbjct: 557 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 594 >gb|EXB93157.1| Ankyrin repeat domain-containing protein 13B [Morus notabilis] Length = 662 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+RGGQ+SDS + KDE+DPFHIP DY+WIDANE Sbjct: 587 MRGSRGGQSSDS-DSHRFKDEVDPFHIPLDYTWIDANE 623 >gb|ACN27704.1| unknown [Zea mays] gi|413924113|gb|AFW64045.1| protein binding protein [Zea mays] Length = 632 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 ++G RG Q+ DS +G++ KDE+DPFHIPSDY+W+DA E Sbjct: 555 VKGGRGTQSGDSGDGRNWKDEVDPFHIPSDYTWVDATE 592 >gb|ACF87656.1| unknown [Zea mays] Length = 545 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 ++G RG Q+ DS +G++ KDE+DPFHIPSDY+W+DA E Sbjct: 468 VKGGRGTQSGDSGDGRNWKDEVDPFHIPSDYTWVDATE 505 >gb|EMT27115.1| hypothetical protein F775_09832 [Aegilops tauschii] Length = 480 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPFHIPS+Y+W+DA E Sbjct: 404 VRGGRGAQSSDSGDSKNWKDEVDPFHIPSEYTWVDATE 441 >ref|XP_003572930.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Brachypodium distachyon] Length = 746 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPFHIPS+Y+W+DA E Sbjct: 670 VRGGRGAQSSDSGDSRNWKDEVDPFHIPSEYTWVDATE 707 >ref|XP_002453012.1| hypothetical protein SORBIDRAFT_04g036710 [Sorghum bicolor] gi|241932843|gb|EES05988.1| hypothetical protein SORBIDRAFT_04g036710 [Sorghum bicolor] Length = 631 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 ++G RG Q+SDS + ++ KDEIDPFHIPSDY+W+DA E Sbjct: 555 VKGGRGTQSSDSGDSRNWKDEIDPFHIPSDYTWVDATE 592 >ref|XP_004142545.1| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus] gi|449479795|ref|XP_004155709.1| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus] Length = 657 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+RGGQ SD G S KDE+DPFHIP DY W+DANE Sbjct: 587 MRGSRGGQLSD---GDSNKDEVDPFHIPPDYIWVDANE 621 >dbj|BAK00886.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 761 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPFHIPS+Y+W+DA E Sbjct: 685 VRGGRGAQSSDSGDSKNWKDEVDPFHIPSEYTWVDAAE 722 >dbj|BAK03521.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533202|dbj|BAJ93573.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 630 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 +RG RG Q+SDS + ++ KDE+DPFHIPS+Y+W+DA E Sbjct: 554 VRGGRGAQSSDSGDSKNWKDEVDPFHIPSEYTWVDAAE 591 >gb|EPS67902.1| hypothetical protein M569_06870, partial [Genlisea aurea] Length = 652 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 MRG+ GQ+SDS E +S +DE+DPFHIPSDYSWID NE Sbjct: 578 MRGSHVGQSSDS-ENRSFQDEVDPFHIPSDYSWIDGNE 614 >ref|XP_004954316.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Setaria italica] Length = 632 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -3 Query: 207 MRGNRGGQTSDSSEGQSCKDEIDPFHIPSDYSWIDANE 94 ++G RG Q+SD + ++ KDE+DPFHIPSDY+W+DA E Sbjct: 555 VKGGRGTQSSDGGDSRNWKDEVDPFHIPSDYTWVDATE 592