BLASTX nr result
ID: Zingiber24_contig00019687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019687 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305937.1| PREDICTED: abscisate beta-glucosyltransferas... 57 3e-06 >ref|XP_004305937.1| PREDICTED: abscisate beta-glucosyltransferase-like [Fragaria vesca subsp. vesca] Length = 501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/78 (44%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = -1 Query: 225 ETERLIEVPGIPQKIHLKLSNLPYVVLHPSELSHRMVESLH---RIHGTVVNSFYELERN 55 ETE + VPG+P KI LK S LP V + SH + E+L G VVNSFYELE+ Sbjct: 173 ETEAFV-VPGLPNKIELKRSMLPDYVKSQNVFSHFLNEALEGEINSDGVVVNSFYELEQA 231 Query: 54 YVDPAPNSRDLRFWFVGP 1 Y D + W VGP Sbjct: 232 YADFFQKEMKRKTWHVGP 249