BLASTX nr result
ID: Zingiber24_contig00019411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019411 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL79568.1| hypothetical protein S23_63860 [Bradyrhizobium s... 91 2e-23 ref|YP_007512427.1| conserved hypothetical protein [Bradyrhizobi... 89 9e-23 ref|WP_006125474.1| conserved hypothetical protein, partial [Str... 101 3e-22 ref|WP_003951215.1| conserved hypothetical protein, partial [Str... 104 1e-20 ref|WP_003948855.1| hypothetical protein [Streptomyces albus] gi... 104 1e-20 ref|WP_009716045.1| conserved hypothetical protein, partial [Str... 103 2e-20 ref|WP_024263321.1| hypothetical protein [Streptomyces filamento... 103 3e-20 ref|WP_009189403.1| hypothetical protein [Streptomyces sp. e14] ... 103 3e-20 ref|WP_007265423.1| hypothetical protein [Streptomyces] gi|19434... 103 3e-20 ref|WP_009068221.1| hypothetical protein [Streptomyces sp. SPB78... 102 5e-20 ref|WP_003789862.1| hypothetical protein [Actinomyces odontolyti... 102 5e-20 ref|WP_004990860.1| conserved hypothetical protein, partial [Str... 101 1e-19 ref|WP_008749163.1| hypothetical protein [Streptomyces sp. SPB74... 100 2e-19 ref|WP_005320117.1| hypothetical protein [Streptomyces pristinae... 99 5e-19 ref|WP_005315412.1| hypothetical protein [Streptomyces pristinae... 99 5e-19 ref|WP_003953578.1| hypothetical protein [Streptomyces clavulige... 99 8e-19 ref|WP_006122416.1| hypothetical protein [Brucella abortus] gi|4... 83 2e-18 ref|WP_008936206.1| hypothetical protein [Brucella sp. 83/13] gi... 83 2e-18 ref|WP_007381066.1| hypothetical protein [Streptomyces sviceus] ... 97 2e-18 ref|WP_002542278.1| hypothetical protein [Propionibacterium acne... 97 3e-18 >dbj|BAL79568.1| hypothetical protein S23_63860 [Bradyrhizobium sp. S23321] Length = 89 Score = 90.9 bits (224), Expect(2) = 2e-23 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +2 Query: 71 VISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKSR 202 +ISREEGGDDVKSSWPLRAGLHTCYNGGDNG LRG+PSQISKSR Sbjct: 1 MISREEGGDDVKSSWPLRAGLHTCYNGGDNGTLRGNPSQISKSR 44 Score = 43.5 bits (101), Expect(2) = 2e-23 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 195 KAGLSSDWGLQLDPMKLESLVIADQ 269 K+ LSSDW LQL+PMKLESLVI DQ Sbjct: 42 KSRLSSDWALQLEPMKLESLVIVDQ 66 >ref|YP_007512427.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] gi|459292957|ref|YP_007516114.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] gi|505479427|ref|WP_015665962.1| hypothetical protein [Bradyrhizobium oligotrophicum] gi|456354395|dbj|BAM88840.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] gi|456358082|dbj|BAM92527.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] Length = 89 Score = 89.0 bits (219), Expect(2) = 9e-23 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +2 Query: 71 VISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKSR 202 +ISREEGGDDVKSSWPLRAGLHTCYNGGD+G LRG+PSQISKSR Sbjct: 1 MISREEGGDDVKSSWPLRAGLHTCYNGGDSGKLRGNPSQISKSR 44 Score = 43.5 bits (101), Expect(2) = 9e-23 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 195 KAGLSSDWGLQLDPMKLESLVIADQ 269 K+ LSSDW LQL+PMKLESLVI DQ Sbjct: 42 KSRLSSDWALQLEPMKLESLVIVDQ 66 >ref|WP_006125474.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291348568|gb|EFE75472.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 96 Score = 101 bits (251), Expect(2) = 3e-22 Identities = 51/69 (73%), Positives = 56/69 (81%) Frame = +2 Query: 74 ISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKSRSQFGLGSATRPHEVGVA 253 ++ EEGGDDVKSS PL GLHTCYNG N + + +ISKSRSQFGLGSATRPHEVGVA Sbjct: 28 VNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSRSQFGLGSATRPHEVGVA 87 Query: 254 SNRRSATLR 280 SNRRSA LR Sbjct: 88 SNRRSALLR 96 Score = 29.3 bits (64), Expect(2) = 3e-22 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 3/27 (11%) Frame = +1 Query: 1 SPATSATPVLSCYHLVEH---SKETAG 72 SPATSAT VL C H + S+ETAG Sbjct: 1 SPATSATLVLCCQHALRRDGDSQETAG 27 >ref|WP_003951215.1| conserved hypothetical protein, partial [Streptomyces albus] gi|291357453|gb|EFE84355.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 87 Score = 104 bits (260), Expect = 1e-20 Identities = 54/70 (77%), Positives = 55/70 (78%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C A +SQKAGLSSDWGLQLDPMK ESLVIA Sbjct: 17 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSESLVIA 76 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 77 DQHCCGEYVP 86 >ref|WP_003948855.1| hypothetical protein [Streptomyces albus] gi|291355076|gb|EFE81978.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 121 Score = 104 bits (260), Expect = 1e-20 Identities = 54/70 (77%), Positives = 55/70 (78%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C A +SQKAGLSSDWGLQLDPMK ESLVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSESLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_009716045.1| conserved hypothetical protein, partial [Streptomyces himastatinicus] gi|302461143|gb|EFL24236.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 53653] Length = 84 Score = 103 bits (258), Expect = 2e-20 Identities = 53/70 (75%), Positives = 54/70 (77%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C +SQKAGLSSDWGLQLDPMKLE LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCEAVRWSESQKAGLSSDWGLQLDPMKLELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_024263321.1| hypothetical protein [Streptomyces filamentosus] gi|586913541|gb|EWS90747.1| hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 103 bits (256), Expect = 3e-20 Identities = 53/70 (75%), Positives = 54/70 (77%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C A +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_009189403.1| hypothetical protein [Streptomyces sp. e14] gi|292833485|gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 103 bits (256), Expect = 3e-20 Identities = 53/70 (75%), Positives = 54/70 (77%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C +SQKAGLSSDWGLQLDPMK ESLVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_007265423.1| hypothetical protein [Streptomyces] gi|194341437|gb|EDX22403.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|302444665|gb|EFL16481.1| conserved hypothetical protein [Streptomyces sp. C] Length = 95 Score = 103 bits (256), Expect = 3e-20 Identities = 53/70 (75%), Positives = 54/70 (77%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C +SQKAGLSSDWGLQLDPMK ESLVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_009068221.1| hypothetical protein [Streptomyces sp. SPB78] gi|302430311|gb|EFL02127.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 121 Score = 102 bits (254), Expect = 5e-20 Identities = 53/70 (75%), Positives = 54/70 (77%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C A +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_003789862.1| hypothetical protein [Actinomyces odontolyticus] gi|153799348|gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 102 bits (254), Expect = 5e-20 Identities = 51/69 (73%), Positives = 55/69 (79%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVGMTS+ H PY LG+T ATMA T GC +S KA LSSDWGLQLDPMK+ESLVIA Sbjct: 7 RKVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVESLVIA 66 Query: 264 DQQRCGEYV 290 DQQRCGEYV Sbjct: 67 DQQRCGEYV 75 >ref|WP_004990860.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291343775|gb|EFE70731.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 134 Score = 101 bits (251), Expect = 1e-19 Identities = 51/69 (73%), Positives = 56/69 (81%) Frame = +2 Query: 74 ISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKSRSQFGLGSATRPHEVGVA 253 ++ EEGGDDVKSS PL GLHTCYNG N + + +ISKSRSQFGLGSATRPHEVGVA Sbjct: 20 VNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRYREVERISKSRSQFGLGSATRPHEVGVA 79 Query: 254 SNRRSATLR 280 SNRRSA LR Sbjct: 80 SNRRSALLR 88 >ref|WP_008749163.1| hypothetical protein [Streptomyces sp. SPB74] gi|295827790|gb|EDY45007.2| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 95 Score = 100 bits (250), Expect = 2e-19 Identities = 52/70 (74%), Positives = 53/70 (75%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_005320117.1| hypothetical protein [Streptomyces pristinaespiralis] gi|297152875|gb|EFH32042.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 121 Score = 99.4 bits (246), Expect = 5e-19 Identities = 51/70 (72%), Positives = 52/70 (74%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA T C +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_005315412.1| hypothetical protein [Streptomyces pristinaespiralis] gi|297151805|gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 99.4 bits (246), Expect = 5e-19 Identities = 51/70 (72%), Positives = 52/70 (74%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA T C +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_003953578.1| hypothetical protein [Streptomyces clavuligerus] gi|197702336|gb|EDY48148.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/70 (72%), Positives = 52/70 (74%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA T C +SQKAGLSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_006122416.1| hypothetical protein [Brucella abortus] gi|479643343|gb|ENS15315.1| hypothetical protein B972_03201 [Brucella abortus F10/05-11] Length = 122 Score = 82.8 bits (203), Expect(2) = 2e-18 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +2 Query: 47 LSTLRRLPVISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKS 199 + TLR LPVISREEGGDDVKSSWPLRAGLHTCYNGGD+G + ISKS Sbjct: 1 MGTLRGLPVISREEGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS 51 Score = 35.4 bits (80), Expect(2) = 2e-18 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 Query: 195 KAGLSSDWGLQLDPMKLESLVIADQ 269 K+ LSSD LQL+ MKLESLVIADQ Sbjct: 50 KSHLSSDCTLQLECMKLESLVIADQ 74 >ref|WP_008936206.1| hypothetical protein [Brucella sp. 83/13] gi|264663256|gb|EEZ33517.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 122 Score = 82.8 bits (203), Expect(2) = 2e-18 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +2 Query: 47 LSTLRRLPVISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKS 199 + TLR LPVISREEGGDDVKSSWPLRAGLHTCYNGGD+G + ISKS Sbjct: 1 MGTLRGLPVISREEGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS 51 Score = 35.4 bits (80), Expect(2) = 2e-18 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 Query: 195 KAGLSSDWGLQLDPMKLESLVIADQ 269 K+ LSSD LQL+ MKLESLVIADQ Sbjct: 50 KSHLSSDCTLQLECMKLESLVIADQ 74 >ref|WP_007381066.1| hypothetical protein [Streptomyces sviceus] gi|297147182|gb|EFH28520.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 137 Score = 97.4 bits (241), Expect = 2e-18 Identities = 51/70 (72%), Positives = 52/70 (74%) Frame = +3 Query: 84 RKVGMTSSPHGPYGLGYTRATMAVTMGC*GATLRKSQKAGLSSDWGLQLDPMKLESLVIA 263 RKVG TSS H PY LG TRATMA TM C +SQKA LSSDWGLQLDPMK E LVIA Sbjct: 13 RKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKACLSSDWGLQLDPMKSELLVIA 72 Query: 264 DQQRCGEYVP 293 DQ CGEYVP Sbjct: 73 DQHCCGEYVP 82 >ref|WP_002542278.1| hypothetical protein [Propionibacterium acnes] gi|313773062|gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 96.7 bits (239), Expect = 3e-18 Identities = 49/69 (71%), Positives = 54/69 (78%) Frame = +2 Query: 74 ISREEGGDDVKSSWPLRAGLHTCYNGGDNGMLRGDPSQISKSRSQFGLGSATRPHEVGVA 253 ++ EEGGDDVKSS PL GLH CYNG + +IS+SRSQFGLGSATRPHEVGVA Sbjct: 37 VNSEEGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVA 96 Query: 254 SNRRSATLR 280 SNRRSATLR Sbjct: 97 SNRRSATLR 105