BLASTX nr result
ID: Zingiber24_contig00019388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019388 (200 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus pe... 72 8e-11 gb|EXB57577.1| hypothetical protein L484_022684 [Morus notabilis] 70 3e-10 ref|XP_006841544.1| hypothetical protein AMTR_s00003p00166290 [A... 68 1e-09 emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] 67 2e-09 ref|XP_004230378.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_006358504.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_002530313.1| pentatricopeptide repeat-containing protein,... 64 3e-08 gb|EOY17477.1| Tetratricopeptide repeat-like superfamily protein... 63 4e-08 ref|XP_003591286.1| Pentatricopeptide repeat-containing protein ... 62 8e-08 ref|XP_004495833.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006480318.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|EMT22393.1| hypothetical protein F775_12763 [Aegilops tauschii] 57 2e-06 ref|NP_001154694.1| pentatricopeptide repeat-containing protein ... 57 3e-06 emb|CAB83319.1| putative protein [Arabidopsis thaliana] 57 3e-06 gb|EMS49336.1| hypothetical protein TRIUR3_05731 [Triticum urartu] 57 3e-06 gb|EAZ00675.1| hypothetical protein OsI_22695 [Oryza sativa Indi... 57 3e-06 ref|XP_006289785.1| hypothetical protein CARUB_v10003387mg [Caps... 56 6e-06 gb|ESW17066.1| hypothetical protein PHAVU_007G207300g [Phaseolus... 55 1e-05 >gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus persica] Length = 314 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/46 (67%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -1 Query: 134 SDDEDENKASTKI--KEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SDD+D+++ +TK KE+DKSKLPPPYDPF+KKPA+E+P DP DLQ Sbjct: 99 SDDKDDDETTTKTATKEIDKSKLPPPYDPFNKKPAIEDPEDPKDLQ 144 >gb|EXB57577.1| hypothetical protein L484_022684 [Morus notabilis] Length = 307 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -1 Query: 134 SDDE--DENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SDDE DEN K++DKSKLPPPYDPFSKKPAVEEP DP DLQ Sbjct: 84 SDDETEDENDNKKAPKDIDKSKLPPPYDPFSKKPAVEEPDDPKDLQ 129 >ref|XP_006841544.1| hypothetical protein AMTR_s00003p00166290 [Amborella trichopoda] gi|548843565|gb|ERN03219.1| hypothetical protein AMTR_s00003p00166290 [Amborella trichopoda] Length = 323 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 131 DDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 +D++E +A K K +DKSKLPPPYDPFSKKP VEEP DP +LQ Sbjct: 105 NDDEEEEAKKKNKVIDKSKLPPPYDPFSKKPVVEEPEDPKNLQ 147 >emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] Length = 347 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD + E E+DKSKLPPPYDPFSKKPA+EEP+DP DLQ Sbjct: 127 SDSDSETMIKKTKHEIDKSKLPPPYDPFSKKPAIEEPKDPKDLQ 170 >ref|XP_004230378.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum lycopersicum] Length = 323 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = -1 Query: 134 SDDEDENKASTKI--KEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD E + K TK+ KE+DKSKLPPPYDPF+KKP +EEP DP++LQ Sbjct: 97 SDAEADTKEITKLSTKEIDKSKLPPPYDPFNKKPVIEEPEDPTNLQ 142 >ref|XP_006358504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum tuberosum] Length = 322 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 +D ++E K+STK ++DKSKLPPPYDPF+KKP +EEP DP++LQ Sbjct: 100 ADTKEETKSSTK--QIDKSKLPPPYDPFNKKPVIEEPEDPTNLQ 141 >ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Vitis vinifera] Length = 307 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD + E E+DKSKLPPPYDPFSKK A+EEP+DP DLQ Sbjct: 87 SDSDSETMIKKTKHEIDKSKLPPPYDPFSKKLAIEEPKDPKDLQ 130 >ref|XP_002530313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530169|gb|EEF32080.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 328 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 128 DEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 D D + +K KE+DK+KLPPPYDPF+KKP +EEP DP++LQ Sbjct: 109 DSDLDSEDSKNKEIDKTKLPPPYDPFNKKPVIEEPDDPNNLQ 150 >gb|EOY17477.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 314 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD + +++ ++ +E+DKSKLPPPYDPF+KKP +EEP+DP +LQ Sbjct: 92 SDSDSDSEEVSRKQELDKSKLPPPYDPFNKKPIIEEPQDPKNLQ 135 >ref|XP_003591286.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355480334|gb|AES61537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 276 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 134 SDDEDENK-ASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD +DEN +TK E+ K+ LPPPYDPFSKKPA+EEP DP DLQ Sbjct: 54 SDSDDENTPTTTKPTEISKN-LPPPYDPFSKKPAIEEPEDPKDLQ 97 >ref|XP_004495833.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Cicer arietinum] Length = 283 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD +DEN T+ + + KLPPPYDPFSKKPA+EEP++P DLQ Sbjct: 64 SDSDDEN---TRKELHNNKKLPPPYDPFSKKPAIEEPKNPKDLQ 104 >ref|XP_006480318.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Citrus sinensis] Length = 282 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SDD+D+N + + ++DKSKLPPPYDPF KK EEP DP +LQ Sbjct: 56 SDDDDDNDDNVSVNKIDKSKLPPPYDPF-KKVVDEEPTDPRNLQ 98 >gb|EMT22393.1| hypothetical protein F775_12763 [Aegilops tauschii] Length = 259 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -1 Query: 137 WSDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 WSDD++ + A LPPPYDPFSKKPAV +P DP++LQ Sbjct: 36 WSDDDESSPAPPPASPAKNPTLPPPYDPFSKKPAVADPPDPTNLQ 80 >ref|NP_001154694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332003244|gb|AED90627.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPP--YDPFSKKPAVEEPRDPSDLQ 3 SDD+ + + T++ E K + PPP YDPFSKKPA+EEP DP +LQ Sbjct: 140 SDDDSDEETETQVTEDSKKQEPPPPPYDPFSKKPAIEEPEDPKNLQ 185 >emb|CAB83319.1| putative protein [Arabidopsis thaliana] Length = 482 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPP--YDPFSKKPAVEEPRDPSDLQ 3 SDD+ + + T++ E K + PPP YDPFSKKPA+EEP DP +LQ Sbjct: 121 SDDDSDEETETQVTEDSKKQEPPPPPYDPFSKKPAIEEPEDPKNLQ 166 >gb|EMS49336.1| hypothetical protein TRIUR3_05731 [Triticum urartu] Length = 269 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -1 Query: 137 WSDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 WSDD++ + A LPPPYDPFSKKPAV +P DP++LQ Sbjct: 47 WSDDDESSPAPPPASPAKNPILPPPYDPFSKKPAVADPPDPTNLQ 91 >gb|EAZ00675.1| hypothetical protein OsI_22695 [Oryza sativa Indica Group] Length = 438 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = -1 Query: 137 WSDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 WSDD+D S E LPPPYDPFSKKPAV EP DP++LQ Sbjct: 113 WSDDDDN--PSPPPMEAKSPNLPPPYDPFSKKPAVMEPSDPTNLQ 155 >ref|XP_006289785.1| hypothetical protein CARUB_v10003387mg [Capsella rubella] gi|482558491|gb|EOA22683.1| hypothetical protein CARUB_v10003387mg [Capsella rubella] Length = 362 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -1 Query: 128 DEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 D+D ++ + I++ K +LPPPYDPFSKKPA+EEP D +LQ Sbjct: 143 DDDSDEETPVIEDSGKPELPPPYDPFSKKPAIEEPEDAKNLQ 184 >gb|ESW17066.1| hypothetical protein PHAVU_007G207300g [Phaseolus vulgaris] Length = 300 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -1 Query: 134 SDDEDENKASTKIKEVDKSKLPPPYDPFSKKPAVEEPRDPSDLQ 3 SD +D+N + K +PPPYDPFSKKPA E+P+DP DLQ Sbjct: 78 SDSDDQNINTQKETGKTNRVVPPPYDPFSKKPATEDPKDPKDLQ 121