BLASTX nr result
ID: Zingiber24_contig00019347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019347 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGW45368.1| sinapyl alcohol dehydrogenase [Pyrus x bretschnei... 59 5e-07 ref|XP_002276703.1| PREDICTED: probable mannitol dehydrogenase [... 59 9e-07 gb|EOX91885.1| Cinnamyl alcohol dehydrogenase 6 [Theobroma cacao] 58 1e-06 ref|XP_002313297.2| hypothetical protein POPTR_0009s06740g [Popu... 57 2e-06 gb|EMJ06608.1| hypothetical protein PRUPE_ppa007605mg [Prunus pe... 57 2e-06 ref|XP_002336182.1| cinnamyl alcohol dehydrogenase-like protein ... 57 2e-06 ref|XP_006466347.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-l... 57 3e-06 ref|XP_006466346.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-l... 57 3e-06 ref|XP_006426237.1| hypothetical protein CICLE_v10026185mg [Citr... 57 3e-06 gb|EMJ08855.1| hypothetical protein PRUPE_ppa021536mg [Prunus pe... 57 3e-06 ref|XP_003635436.1| PREDICTED: probable mannitol dehydrogenase-l... 57 3e-06 emb|CBI18803.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002313293.2| hypothetical protein POPTR_0009s06790g [Popu... 57 3e-06 ref|XP_002313294.2| hypothetical protein POPTR_0009s06770g [Popu... 57 3e-06 ref|XP_006379102.1| hypothetical protein POPTR_0009s06750g, part... 57 3e-06 gb|AGU43754.1| cinnamyl alcohol dehydrogenase 6 [Populus tomentosa] 57 3e-06 ref|XP_003635280.1| PREDICTED: probable mannitol dehydrogenase-l... 57 3e-06 ref|XP_003635250.1| PREDICTED: probable mannitol dehydrogenase-l... 57 3e-06 ref|XP_006426236.1| hypothetical protein CICLE_v10025755mg [Citr... 56 6e-06 gb|EMJ07741.1| hypothetical protein PRUPE_ppa018829mg [Prunus pe... 56 6e-06 >gb|AGW45368.1| sinapyl alcohol dehydrogenase [Pyrus x bretschneideri] Length = 362 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSAA 239 ISMDYVN AMERLAK DVRYRFV+D+GNTL+A+ Sbjct: 328 ISMDYVNTAMERLAKNDVRYRFVIDVGNTLAAS 360 >ref|XP_002276703.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera] gi|297745619|emb|CBI40784.3| unnamed protein product [Vitis vinifera] Length = 376 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSAA 239 ISMDY+N AMERLAK DVRYRFV+DIGNTL+A+ Sbjct: 342 ISMDYINTAMERLAKGDVRYRFVIDIGNTLAAS 374 >gb|EOX91885.1| Cinnamyl alcohol dehydrogenase 6 [Theobroma cacao] Length = 362 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDYVNKAMERL K DVRYRFV+DIGNTL A Sbjct: 328 ISMDYVNKAMERLGKGDVRYRFVIDIGNTLVA 359 >ref|XP_002313297.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa] gi|550331192|gb|EEE87252.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa] Length = 360 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL+KTDVRYRFV+DIGNT+ Sbjct: 329 ISMDYVNTAMERLSKTDVRYRFVIDIGNTM 358 >gb|EMJ06608.1| hypothetical protein PRUPE_ppa007605mg [Prunus persica] Length = 362 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISM+YVN AMERLAK DVRYRFV+D+GNTL+A Sbjct: 328 ISMEYVNTAMERLAKNDVRYRFVIDVGNTLAA 359 >ref|XP_002336182.1| cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] gi|566186687|ref|XP_006379103.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa] gi|550331196|gb|ERP56900.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa] Length = 360 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL+KTDVRYRFV+DIGNT+ Sbjct: 329 ISMDYVNTAMERLSKTDVRYRFVIDIGNTM 358 >ref|XP_006466347.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Citrus sinensis] Length = 362 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDYVN AMERLAK DVRYRFV+DI NTL+A Sbjct: 328 ISMDYVNTAMERLAKADVRYRFVIDIANTLAA 359 >ref|XP_006466346.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Citrus sinensis] Length = 393 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDYVN AMERLAK DVRYRFV+DI NTL+A Sbjct: 359 ISMDYVNTAMERLAKADVRYRFVIDIANTLAA 390 >ref|XP_006426237.1| hypothetical protein CICLE_v10026185mg [Citrus clementina] gi|557528227|gb|ESR39477.1| hypothetical protein CICLE_v10026185mg [Citrus clementina] Length = 295 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDYVN AMERLAK DVRYRFV+DI NTL+A Sbjct: 261 ISMDYVNTAMERLAKADVRYRFVIDIANTLAA 292 >gb|EMJ08855.1| hypothetical protein PRUPE_ppa021536mg [Prunus persica] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDY+N A+ERLAK DVRYRFV+DIGNTL+A Sbjct: 329 ISMDYLNTALERLAKNDVRYRFVIDIGNTLAA 360 >ref|XP_003635436.1| PREDICTED: probable mannitol dehydrogenase-like isoform 2 [Vitis vinifera] gi|359497143|ref|XP_002266559.2| PREDICTED: probable mannitol dehydrogenase-like isoform 1 [Vitis vinifera] Length = 360 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSAA 239 IS+DYVN AMERL K DVRYRFV+DIGNTL AA Sbjct: 328 ISIDYVNTAMERLQKADVRYRFVIDIGNTLKAA 360 >emb|CBI18803.3| unnamed protein product [Vitis vinifera] Length = 333 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSAA 239 IS+DYVN AMERL K DVRYRFV+DIGNTL AA Sbjct: 301 ISIDYVNTAMERLQKADVRYRFVIDIGNTLKAA 333 >ref|XP_002313293.2| hypothetical protein POPTR_0009s06790g [Populus trichocarpa] gi|550331197|gb|EEE87248.2| hypothetical protein POPTR_0009s06790g [Populus trichocarpa] Length = 380 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL KTDVRYRFV+DIGNT+ Sbjct: 349 ISMDYVNTAMERLLKTDVRYRFVIDIGNTM 378 >ref|XP_002313294.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa] gi|550331195|gb|EEE87249.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa] Length = 360 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL KTDVRYRFV+DIGNT+ Sbjct: 329 ISMDYVNTAMERLMKTDVRYRFVIDIGNTM 358 >ref|XP_006379102.1| hypothetical protein POPTR_0009s06750g, partial [Populus trichocarpa] gi|550331193|gb|ERP56899.1| hypothetical protein POPTR_0009s06750g, partial [Populus trichocarpa] Length = 65 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL KTDVRYRFV+DIGNT+ Sbjct: 34 ISMDYVNTAMERLLKTDVRYRFVIDIGNTM 63 >gb|AGU43754.1| cinnamyl alcohol dehydrogenase 6 [Populus tomentosa] Length = 360 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 ISMDYVN AMERL KTDVRYRFV+DIGNT+ Sbjct: 329 ISMDYVNTAMERLLKTDVRYRFVIDIGNTM 358 >ref|XP_003635280.1| PREDICTED: probable mannitol dehydrogenase-like [Vitis vinifera] gi|297741856|emb|CBI33216.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 + MDYVN AMERLAK DVRYRFV+DIGN+LSA Sbjct: 328 VPMDYVNTAMERLAKADVRYRFVIDIGNSLSA 359 >ref|XP_003635250.1| PREDICTED: probable mannitol dehydrogenase-like [Vitis vinifera] gi|296086961|emb|CBI33194.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 + MDYVN AMERLAK DVRYRFV+DIGN+LSA Sbjct: 328 VPMDYVNTAMERLAKADVRYRFVIDIGNSLSA 359 >ref|XP_006426236.1| hypothetical protein CICLE_v10025755mg [Citrus clementina] gi|557528226|gb|ESR39476.1| hypothetical protein CICLE_v10025755mg [Citrus clementina] Length = 406 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTLSA 242 ISMDYVN AMERLAK DVRYRFV+DI NTL A Sbjct: 372 ISMDYVNTAMERLAKADVRYRFVIDIANTLYA 403 >gb|EMJ07741.1| hypothetical protein PRUPE_ppa018829mg [Prunus persica] Length = 364 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 337 ISMDYVNKAMERLAKTDVRYRFVLDIGNTL 248 I +DYVN AMERLAKTDVRYRFV+DIGNTL Sbjct: 331 IPIDYVNTAMERLAKTDVRYRFVIDIGNTL 360