BLASTX nr result
ID: Zingiber24_contig00019116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00019116 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] 67 3e-09 gb|AAW34137.1| cysteine protease gp3b [Zingiber officinale] 67 3e-09 gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] 66 4e-09 gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale] 65 7e-09 gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii] 64 2e-08 gb|EMS56635.1| Oryzain alpha chain [Triticum urartu] 64 2e-08 dbj|BAF02546.1| triticain alpha [Triticum aestivum] gi|388890585... 64 2e-08 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] 60 2e-07 gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus n... 59 5e-07 dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare... 59 5e-07 ref|XP_003580684.1| PREDICTED: oryzain alpha chain-like [Brachyp... 59 7e-07 ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi... 59 7e-07 gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease... 59 9e-07 dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica] 59 9e-07 ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutr... 58 1e-06 dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis] 58 1e-06 gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elae... 58 1e-06 ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [S... 57 2e-06 >gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] Length = 381 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSDEEVR+LYLEWR K+ P + LD + R E+FK+NL++VDEHNA Sbjct: 44 RSDEEVRMLYLEWRVKNHPAEKYLDLNEYRLEVFKENLQFVDEHNA 89 >gb|AAW34137.1| cysteine protease gp3b [Zingiber officinale] Length = 466 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSDEEVR++Y EWR+KHRP +N R E+FK+NLR+VDEHNA Sbjct: 34 RSDEEVRIIYQEWRAKHRPAENDQYVGDYRLEVFKENLRFVDEHNA 79 >gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] Length = 379 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSDEEVR+LYLEWR+K+ P + LD + R E+FK+NL++VD+HNA Sbjct: 42 RSDEEVRMLYLEWRAKNHPAEKYLDLNEYRLEVFKENLQFVDKHNA 87 >gb|AAW34136.1| cysteine protease gp3a [Zingiber officinale] Length = 475 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSDEEVR++Y EWR KHRP +N R E+FK+NLR+VDEHNA Sbjct: 43 RSDEEVRIIYQEWRVKHRPAENDQYVGDYRLEVFKENLRFVDEHNA 88 >gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii] Length = 463 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNLRY+D+HNA Sbjct: 34 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 79 >gb|EMS56635.1| Oryzain alpha chain [Triticum urartu] Length = 483 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNLRY+D+HNA Sbjct: 32 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 77 >dbj|BAF02546.1| triticain alpha [Triticum aestivum] gi|388890585|gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum durum] Length = 461 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW S+HR NA+ + RFE+F+DNLRY+D+HNA Sbjct: 32 RSEEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNA 77 >gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] Length = 469 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSD+EV LY W+++H NALD D R EIF+DNLR++D+HNA Sbjct: 38 RSDDEVHRLYQAWKAQHARSYNALDEDEQRLEIFRDNLRFIDQHNA 83 >gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus notabilis] Length = 361 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSD EVR +Y++W + H N L + RFEIFKDNLR+VDEHNA Sbjct: 23 RSDAEVREMYVKWMATHGRAHNGLGEEETRFEIFKDNLRFVDEHNA 68 >dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 289 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNLRY+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 436 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNLRY+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare] gi|326513690|dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326514532|dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 463 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y EW ++H NA+ + RFE F+DNLRY+D+HNA Sbjct: 34 RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNA 79 >ref|XP_003580684.1| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon] Length = 456 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EEVR +Y+EW +++ NA+ + RFE+F+DNLRYVD+HNA Sbjct: 33 RSEEEVRRMYVEWMAENGRTYNAIGEEERRFEVFRDNLRYVDQHNA 78 >ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi|355492134|gb|AES73337.1| Cysteine proteinase [Medicago truncatula] Length = 474 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFD--GDRFEIFKDNLRYVDEHNA 203 RSD+EV+ +Y EWR KH L N +D RFEIFKDNL+++DEHNA Sbjct: 44 RSDKEVKNIYEEWRVKHGKLNNNIDGSEKDKRFEIFKDNLKFIDEHNA 91 >gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea] Length = 485 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHN 200 RSD EV LY EW KH QN+L RFEIFKDNLR++DEHN Sbjct: 39 RSDAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDEHN 83 >dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica] Length = 441 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHN 200 RSD EV LY EW KH QN+L RFEIFKDNLR++DEHN Sbjct: 33 RSDAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDEHN 77 >ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum] gi|557090198|gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum] Length = 459 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RSD EV+ LY W KH +QN+L RFEIFKDNLR++D+HNA Sbjct: 40 RSDAEVKRLYETWLVKHGKVQNSLVEKDRRFEIFKDNLRFIDDHNA 85 >dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis] Length = 431 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHN 200 RSD EV LY EW KH QN+L RFEIFKDNLR++DEHN Sbjct: 33 RSDVEVSRLYEEWVVKHGKAQNSLTEKDRRFEIFKDNLRFIDEHN 77 >gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elaeis guineensis] Length = 525 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 RS+EE+RLLY W +KH NAL RFEIFKDN+R++D HNA Sbjct: 41 RSEEEMRLLYEGWLAKHGRADNALGEKERRFEIFKDNVRFIDAHNA 86 >ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum] Length = 471 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 Query: 66 RSDEEVRLLYLEWRSKHRPLQNALDFDGDRFEIFKDNLRYVDEHNA 203 R+D+EV LY W +H+ + NAL RF+IFKDNL+Y+DEHNA Sbjct: 45 RTDDEVMSLYESWLVEHKKVYNALGEKDKRFQIFKDNLKYIDEHNA 90