BLASTX nr result
ID: Zingiber24_contig00018972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00018972 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296433.1| PREDICTED: auxin-responsive protein IAA33-li... 64 2e-08 ref|XP_006381794.1| hypothetical protein POPTR_0006s18260g [Popu... 60 3e-07 gb|EMJ27944.1| hypothetical protein PRUPE_ppa018956mg [Prunus pe... 59 7e-07 ref|XP_002324470.2| hypothetical protein POPTR_0018s10000g [Popu... 58 1e-06 gb|EOY31891.1| Indole-3-acetic acid inducible 33 [Theobroma cacao] 58 1e-06 ref|XP_002329637.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_002268816.1| PREDICTED: auxin-responsive protein IAA33 [V... 58 1e-06 ref|XP_004151050.1| PREDICTED: auxin-responsive protein IAA33-li... 57 2e-06 ref|XP_002532238.1| transcription factor, putative [Ricinus comm... 57 3e-06 ref|XP_006474183.1| PREDICTED: auxin-responsive protein IAA33-li... 57 3e-06 gb|ESW26757.1| hypothetical protein PHAVU_003G145600g [Phaseolus... 57 3e-06 ref|XP_006453372.1| hypothetical protein CICLE_v10010470mg [Citr... 57 3e-06 gb|AFK34962.1| unknown [Lotus japonicus] 56 6e-06 ref|XP_003610114.1| Indole-3-acetic acid inducible [Medicago tru... 55 7e-06 ref|XP_006845639.1| hypothetical protein AMTR_s00019p00222170 [A... 55 1e-05 >ref|XP_004296433.1| PREDICTED: auxin-responsive protein IAA33-like [Fragaria vesca subsp. vesca] Length = 167 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRHCGKRA 112 DLLLAGDLNWKDFVRVAKRIRI+P+KAN RR G+R+ Sbjct: 130 DLLLAGDLNWKDFVRVAKRIRILPAKANSRRGGGRRS 166 >ref|XP_006381794.1| hypothetical protein POPTR_0006s18260g [Populus trichocarpa] gi|550336550|gb|ERP59591.1| hypothetical protein POPTR_0006s18260g [Populus trichocarpa] Length = 173 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRHCGKRA 112 DLLLAGDLNWKDFVRVAKRIRI+P+K N R+ G A Sbjct: 137 DLLLAGDLNWKDFVRVAKRIRILPAKGNSRKRTGGAA 173 >gb|EMJ27944.1| hypothetical protein PRUPE_ppa018956mg [Prunus persica] Length = 162 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNWKDFVRVAKRIRI+P+K N RR Sbjct: 127 DLLLAGDLNWKDFVRVAKRIRILPAKGNSRR 157 >ref|XP_002324470.2| hypothetical protein POPTR_0018s10000g [Populus trichocarpa] gi|550318435|gb|EEF03035.2| hypothetical protein POPTR_0018s10000g [Populus trichocarpa] Length = 175 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRHCGKRA 112 DLLLAGDLNW+DFVRVAKRIRI+P+K N R+ G A Sbjct: 138 DLLLAGDLNWQDFVRVAKRIRILPAKGNSRKATGGTA 174 >gb|EOY31891.1| Indole-3-acetic acid inducible 33 [Theobroma cacao] Length = 176 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNWKDFVRVAKRIRI+P+K N R+ Sbjct: 141 DLLLAGDLNWKDFVRVAKRIRILPAKGNSRK 171 >ref|XP_002329637.1| predicted protein [Populus trichocarpa] Length = 117 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNWKDFVRVAKRIRI+P+K N R+ Sbjct: 87 DLLLAGDLNWKDFVRVAKRIRILPAKGNSRK 117 >ref|XP_002268816.1| PREDICTED: auxin-responsive protein IAA33 [Vitis vinifera] gi|297735399|emb|CBI17839.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRHCG 103 DLLLAGDLNWKDFVRVAKRIRI+P+K N R+ G Sbjct: 133 DLLLAGDLNWKDFVRVAKRIRILPAKRNSRKGRG 166 >ref|XP_004151050.1| PREDICTED: auxin-responsive protein IAA33-like [Cucumis sativus] Length = 144 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNW DFVRVAKRIRI+P KAN RR Sbjct: 110 DLLLAGDLNWNDFVRVAKRIRILPVKANSRR 140 >ref|XP_002532238.1| transcription factor, putative [Ricinus communis] gi|223528072|gb|EEF30147.1| transcription factor, putative [Ricinus communis] Length = 173 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRHCG 103 DLLLAGDLNWKDFVRVAKRIRI+P K N R+ G Sbjct: 138 DLLLAGDLNWKDFVRVAKRIRILPVKGNSRKGRG 171 >ref|XP_006474183.1| PREDICTED: auxin-responsive protein IAA33-like [Citrus sinensis] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNWKDFVRVAKRIRI+P K N R+ Sbjct: 133 DLLLAGDLNWKDFVRVAKRIRILPVKGNSRK 163 >gb|ESW26757.1| hypothetical protein PHAVU_003G145600g [Phaseolus vulgaris] Length = 168 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDL+WKDFVRVAKRIRI+P+K N R+ Sbjct: 131 DLLLAGDLSWKDFVRVAKRIRIIPTKGNSRK 161 >ref|XP_006453372.1| hypothetical protein CICLE_v10010470mg [Citrus clementina] gi|557556598|gb|ESR66612.1| hypothetical protein CICLE_v10010470mg [Citrus clementina] Length = 181 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDLNWKDFVRVAKRIRI+P K N R+ Sbjct: 145 DLLLAGDLNWKDFVRVAKRIRILPVKGNSRK 175 >gb|AFK34962.1| unknown [Lotus japonicus] Length = 162 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDL+WKDFVRVAKRIRI+P+K N R+ Sbjct: 124 DLLLAGDLSWKDFVRVAKRIRILPAKGNSRK 154 >ref|XP_003610114.1| Indole-3-acetic acid inducible [Medicago truncatula] gi|355511169|gb|AES92311.1| Indole-3-acetic acid inducible [Medicago truncatula] Length = 173 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRR 94 DLLLAGDL WKDFVRVAKRIRI+P+K N R+ Sbjct: 135 DLLLAGDLTWKDFVRVAKRIRILPAKGNSRK 165 >ref|XP_006845639.1| hypothetical protein AMTR_s00019p00222170 [Amborella trichopoda] gi|548848211|gb|ERN07314.1| hypothetical protein AMTR_s00019p00222170 [Amborella trichopoda] Length = 161 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 DLLLAGDLNWKDFVRVAKRIRIVPSKANRRRH 97 DLLLAGDLNWKDFVRVAKRIRI+P KA ++ + Sbjct: 127 DLLLAGDLNWKDFVRVAKRIRILPVKAKQKAY 158