BLASTX nr result
ID: Zingiber24_contig00018668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00018668 (603 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518486.1| conserved hypothetical protein [Ricinus comm... 60 5e-07 >ref|XP_002518486.1| conserved hypothetical protein [Ricinus communis] gi|223542331|gb|EEF43873.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 60.1 bits (144), Expect = 5e-07 Identities = 53/170 (31%), Positives = 66/170 (38%), Gaps = 32/170 (18%) Frame = -3 Query: 415 DLPDLSEDDVWPAFSDDHSSAEIDDDYHR------W-PRTD------RGGDGRWADRHVG 275 D +L E+DVW D + +D+ W PR D R R DRHVG Sbjct: 33 DSSELGEEDVWSMVDDGDDDGDRNDNQLMNNSQGDWSPRADFESMRSRRRIPRGDDRHVG 92 Query: 274 GLSLAFEEAYRG-----------------TAAPPRREKRIXXXXXXXXXXXXXPRHLRAX 146 GLSLAFE++ G AAPP + LR Sbjct: 93 GLSLAFEDSSSGKTASSRIVHQFRGHHDSVAAPPAAASPRHMATSAPVNVPDWSKILRVD 152 Query: 145 XXXXXXXXXXXXXXXETEWLPPHEYLAREHGRS--AATSSVLEGAGRTLK 2 ++E +PPHEYLAR + RS +SV EG GRTLK Sbjct: 153 SVESLHDLDDGFDEGDSEMVPPHEYLARVYARSRKMGNASVFEGVGRTLK 202