BLASTX nr result
ID: Zingiber24_contig00017900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017900 (256 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004253047.1| PREDICTED: protein TIC 55, chloroplastic-lik... 105 8e-21 ref|XP_006342449.1| PREDICTED: protein TIC 55, chloroplastic-lik... 103 3e-20 ref|XP_002515391.1| chlorophyll a oxygenase, putative [Ricinus c... 103 3e-20 ref|XP_002309693.1| hypothetical protein POPTR_0006s28310g [Popu... 103 3e-20 ref|XP_006405047.1| hypothetical protein EUTSA_v10000113mg [Eutr... 102 5e-20 ref|XP_004954189.1| PREDICTED: protein TIC 55, chloroplastic-lik... 102 7e-20 ref|XP_006293906.1| hypothetical protein CARUB_v10022898mg, part... 101 9e-20 ref|XP_003522345.2| PREDICTED: protein TIC 55, chloroplastic-lik... 101 1e-19 ref|XP_002878803.1| hypothetical protein ARALYDRAFT_901077 [Arab... 101 1e-19 ref|NP_180055.1| translocon at the inner envelope membrane of ch... 101 1e-19 gb|EXC18768.1| Protein TIC 55 [Morus notabilis] 100 2e-19 gb|ESW08924.1| hypothetical protein PHAVU_009G086000g [Phaseolus... 100 2e-19 gb|EOY29301.1| Translocon at the inner envelope membrane of chlo... 100 2e-19 ref|XP_006845452.1| hypothetical protein AMTR_s00019p00118960 [A... 100 2e-19 gb|EMJ24261.1| hypothetical protein PRUPE_ppa003700mg [Prunus pe... 100 2e-19 gb|EMJ24121.1| hypothetical protein PRUPE_ppa003695mg [Prunus pe... 100 2e-19 ref|XP_002283433.2| PREDICTED: protein TIC 55, chloroplastic-lik... 100 2e-19 ref|XP_006483514.1| PREDICTED: protein TIC 55, chloroplastic-lik... 100 3e-19 ref|XP_006450242.1| hypothetical protein CICLE_v10007965mg [Citr... 100 3e-19 ref|XP_004291983.1| PREDICTED: protein TIC 55, chloroplastic-lik... 100 3e-19 >ref|XP_004253047.1| PREDICTED: protein TIC 55, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460415403|ref|XP_004253048.1| PREDICTED: protein TIC 55, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 560 Score = 105 bits (261), Expect = 8e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VPNDAPLGL+VFDKQ+VL++DG G LRCFEDRCPHRLA Sbjct: 99 YDWTEEWYPLYLTKNVPNDAPLGLTVFDKQVVLYKDGSGELRCFEDRCPHRLA 151 >ref|XP_006342449.1| PREDICTED: protein TIC 55, chloroplastic-like [Solanum tuberosum] Length = 549 Score = 103 bits (256), Expect = 3e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFDKQ+VL++DG G LRCFEDRCPHRLA Sbjct: 88 YDWTEEWYPLYLTKNVPDDAPLGLTVFDKQVVLYKDGSGELRCFEDRCPHRLA 140 >ref|XP_002515391.1| chlorophyll a oxygenase, putative [Ricinus communis] gi|223545335|gb|EEF46840.1| chlorophyll a oxygenase, putative [Ricinus communis] Length = 552 Score = 103 bits (256), Expect = 3e-20 Identities = 42/53 (79%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFDKQ+VL++DG+G LRC+EDRCPHRLA Sbjct: 96 YDWTEEWYPLYLTKDVPDDAPLGLTVFDKQIVLYKDGEGELRCYEDRCPHRLA 148 >ref|XP_002309693.1| hypothetical protein POPTR_0006s28310g [Populus trichocarpa] gi|222855669|gb|EEE93216.1| hypothetical protein POPTR_0006s28310g [Populus trichocarpa] Length = 556 Score = 103 bits (256), Expect = 3e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFDKQ+VL++DG G LRCFEDRCPHRLA Sbjct: 100 YDWTEEWYPLYLTKDVPDDAPLGLTVFDKQVVLYKDGQGELRCFEDRCPHRLA 152 >ref|XP_006405047.1| hypothetical protein EUTSA_v10000113mg [Eutrema salsugineum] gi|557106175|gb|ESQ46500.1| hypothetical protein EUTSA_v10000113mg [Eutrema salsugineum] Length = 544 Score = 102 bits (254), Expect = 5e-20 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT VP+DAPLGL+VFD+Q+VL++DG+G LRC+EDRCPHRLA Sbjct: 88 YDWTEEWYPLYLTRDVPDDAPLGLTVFDRQIVLYKDGEGTLRCYEDRCPHRLA 140 >ref|XP_004954189.1| PREDICTED: protein TIC 55, chloroplastic-like [Setaria italica] Length = 551 Score = 102 bits (253), Expect = 7e-20 Identities = 50/87 (57%), Positives = 59/87 (67%), Gaps = 4/87 (4%) Frame = -3 Query: 251 RCRAAVA----AEDVGRXXXXXXXXXXXXXXXXEYDWREEWYPLYLTEQVPNDAPLGLSV 84 RCRAAV A++ G YDW+EEWYPLYL ++VP+DA L L+V Sbjct: 61 RCRAAVVEEAGAQEDGVLLPKEGDDAAATAAAGRYDWKEEWYPLYLAKEVPDDAALPLTV 120 Query: 83 FDKQLVLFRDGDGVLRCFEDRCPHRLA 3 FD+QLVL+RDGDGVLRC EDRCPHRLA Sbjct: 121 FDRQLVLWRDGDGVLRCHEDRCPHRLA 147 >ref|XP_006293906.1| hypothetical protein CARUB_v10022898mg, partial [Capsella rubella] gi|482562614|gb|EOA26804.1| hypothetical protein CARUB_v10022898mg, partial [Capsella rubella] Length = 575 Score = 101 bits (252), Expect = 9e-20 Identities = 40/53 (75%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+V+D+Q+VL++DG+G LRC+EDRCPHRLA Sbjct: 118 YDWTEEWYPLYLTKNVPDDAPLGLTVYDRQIVLYKDGEGTLRCYEDRCPHRLA 170 >ref|XP_003522345.2| PREDICTED: protein TIC 55, chloroplastic-like [Glycine max] Length = 575 Score = 101 bits (251), Expect = 1e-19 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW +EWYPLYLT+ VP DAPLGL VFDKQLVLF+DG+G RC+EDRCPHRLA Sbjct: 119 YDWTQEWYPLYLTQNVPEDAPLGLRVFDKQLVLFKDGNGQFRCYEDRCPHRLA 171 >ref|XP_002878803.1| hypothetical protein ARALYDRAFT_901077 [Arabidopsis lyrata subsp. lyrata] gi|297324642|gb|EFH55062.1| hypothetical protein ARALYDRAFT_901077 [Arabidopsis lyrata subsp. lyrata] Length = 539 Score = 101 bits (251), Expect = 1e-19 Identities = 39/53 (73%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ +P+DAPLGL+V+D+Q+VL++DG+G LRC+EDRCPHRLA Sbjct: 82 YDWTEEWYPLYLTKNIPDDAPLGLTVYDRQIVLYKDGEGTLRCYEDRCPHRLA 134 >ref|NP_180055.1| translocon at the inner envelope membrane of chloroplasts 55-II [Arabidopsis thaliana] gi|75265982|sp|Q9SK50.1|TIC55_ARATH RecName: Full=Protein TIC 55, chloroplastic; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 55; Short=AtTIC55; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 55-II; Flags: Precursor gi|4559369|gb|AAD23030.1| putative Rieske iron-sulfur protein [Arabidopsis thaliana] gi|330252538|gb|AEC07632.1| translocon at the inner envelope membrane of chloroplasts 55-II [Arabidopsis thaliana] Length = 539 Score = 101 bits (251), Expect = 1e-19 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP DAPLGL+V+D+Q+VL++DG+G LRC+EDRCPHRLA Sbjct: 82 YDWTEEWYPLYLTKNVPEDAPLGLTVYDRQIVLYKDGEGTLRCYEDRCPHRLA 134 >gb|EXC18768.1| Protein TIC 55 [Morus notabilis] Length = 541 Score = 100 bits (250), Expect = 2e-19 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ +P+DAPLGL+VFDKQLVL+RDG G LRC EDRCPHRLA Sbjct: 85 YDWTEEWYPLYLTKNLPHDAPLGLTVFDKQLVLYRDGAGELRCHEDRCPHRLA 137 >gb|ESW08924.1| hypothetical protein PHAVU_009G086000g [Phaseolus vulgaris] Length = 576 Score = 100 bits (250), Expect = 2e-19 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP DAPLGL+VFDKQLVLF+DG+ RC+EDRCPHRLA Sbjct: 120 YDWTEEWYPLYLTQNVPEDAPLGLTVFDKQLVLFKDGNSQFRCYEDRCPHRLA 172 >gb|EOY29301.1| Translocon at the inner envelope membrane of chloroplasts 55-II [Theobroma cacao] Length = 551 Score = 100 bits (250), Expect = 2e-19 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFD+QLVL++DG GVL C++DRCPHRLA Sbjct: 95 YDWTEEWYPLYLTKDVPDDAPLGLTVFDQQLVLYKDGSGVLHCYQDRCPHRLA 147 >ref|XP_006845452.1| hypothetical protein AMTR_s00019p00118960 [Amborella trichopoda] gi|548848024|gb|ERN07127.1| hypothetical protein AMTR_s00019p00118960 [Amborella trichopoda] Length = 552 Score = 100 bits (249), Expect = 2e-19 Identities = 41/53 (77%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 Y+W+EEWYPLYL++ VP+DAPLGL+VFD QLVL+RDG+G+LRC EDRCPHRLA Sbjct: 97 YNWKEEWYPLYLSKDVPDDAPLGLTVFDHQLVLYRDGNGILRCHEDRCPHRLA 149 >gb|EMJ24261.1| hypothetical protein PRUPE_ppa003700mg [Prunus persica] Length = 555 Score = 100 bits (249), Expect = 2e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ +P DAPLGL+VFDKQLVL+RDG G+LRC+EDRC HRLA Sbjct: 99 YDWTEEWYPLYLTQDLPEDAPLGLTVFDKQLVLYRDGSGLLRCYEDRCCHRLA 151 >gb|EMJ24121.1| hypothetical protein PRUPE_ppa003695mg [Prunus persica] Length = 555 Score = 100 bits (249), Expect = 2e-19 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ +P+DAPLGL+VFDKQLVL++DG G L+C++DRCPHRLA Sbjct: 99 YDWTEEWYPLYLTQDIPDDAPLGLTVFDKQLVLYKDGSGELQCYQDRCPHRLA 151 >ref|XP_002283433.2| PREDICTED: protein TIC 55, chloroplastic-like [Vitis vinifera] gi|296082166|emb|CBI21171.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 100 bits (249), Expect = 2e-19 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW+EEWYPLYLT+ +P DAP+GL+VFDKQLVL+RDG +L+C+EDRCPHRLA Sbjct: 88 YDWKEEWYPLYLTKDIPEDAPMGLTVFDKQLVLYRDGKDLLQCYEDRCPHRLA 140 >ref|XP_006483514.1| PREDICTED: protein TIC 55, chloroplastic-like [Citrus sinensis] Length = 534 Score = 100 bits (248), Expect = 3e-19 Identities = 40/53 (75%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFD+Q+VL++DG+G LRC++DRCPHRLA Sbjct: 77 YDWTEEWYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGNGELRCYQDRCPHRLA 129 >ref|XP_006450242.1| hypothetical protein CICLE_v10007965mg [Citrus clementina] gi|557553468|gb|ESR63482.1| hypothetical protein CICLE_v10007965mg [Citrus clementina] Length = 534 Score = 100 bits (248), Expect = 3e-19 Identities = 40/53 (75%), Positives = 50/53 (94%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ VP+DAPLGL+VFD+Q+VL++DG+G LRC++DRCPHRLA Sbjct: 77 YDWTEEWYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGNGELRCYQDRCPHRLA 129 >ref|XP_004291983.1| PREDICTED: protein TIC 55, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 546 Score = 100 bits (248), Expect = 3e-19 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -3 Query: 161 YDWREEWYPLYLTEQVPNDAPLGLSVFDKQLVLFRDGDGVLRCFEDRCPHRLA 3 YDW EEWYPLYLT+ +P DAPLGL+VFDKQLVL+RD GVL+C++DRCPHRLA Sbjct: 85 YDWTEEWYPLYLTQDLPEDAPLGLTVFDKQLVLYRDAKGVLQCYQDRCPHRLA 137