BLASTX nr result
ID: Zingiber24_contig00017678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017678 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523120.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 1e-08 ref|XP_004501838.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 8e-08 ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 1e-07 ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing... 60 3e-07 ref|XP_006394307.1| hypothetical protein EUTSA_v10004447mg [Eutr... 60 4e-07 dbj|BAE71259.1| hypothetical protein [Trifolium pratense] 60 4e-07 ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 5e-07 gb|ESW09972.1| hypothetical protein PHAVU_009G170600g [Phaseolus... 59 5e-07 ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citr... 59 5e-07 ref|XP_006439989.1| hypothetical protein CICLE_v10020762mg [Citr... 59 5e-07 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 5e-07 ref|XP_004152501.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 5e-07 ref|XP_004137576.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 5e-07 ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 7e-07 gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 59 7e-07 ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing... 59 9e-07 ref|XP_002866538.1| hypothetical protein ARALYDRAFT_919604 [Arab... 59 9e-07 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 58 1e-06 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 58 1e-06 ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thali... 58 1e-06 >ref|XP_003523120.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Glycine max] Length = 327 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/83 (44%), Positives = 46/83 (55%), Gaps = 20/83 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG F TC GLQ L+ HL C+RK Sbjct: 192 LYVQLSEAMECLEHICTEGCTEVGPYEVEVGRQKTPCSKFATCQGLQVLIRHLGTCNRKL 251 Query: 69 KPHFFL*FKRLWQLLHLHASICL 1 K L KR+WQL LH+SICL Sbjct: 252 KGG-CLRCKRMWQLFRLHSSICL 273 >ref|XP_004501838.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Cicer arietinum] Length = 339 Score = 62.0 bits (149), Expect = 8e-08 Identities = 36/82 (43%), Positives = 44/82 (53%), Gaps = 19/82 (23%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG-------------------FGTCYGLQKLVHHLAICDRKKK 67 +Y +LS+AMECL+HI +EG F TC GLQ L+ H A C R K Sbjct: 196 LYVQLSEAMECLEHICTEGCTNVAPYDVKKQRKRPCSKFSTCEGLQVLIRHFATCKRNLK 255 Query: 66 PHFFL*FKRLWQLLHLHASICL 1 L KR+WQL LH+SICL Sbjct: 256 GG-CLRCKRMWQLFRLHSSICL 276 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/82 (42%), Positives = 45/82 (54%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AM+CL+HI +EG F TC GLQ L+ H A C R+ Sbjct: 199 LYLQLSEAMDCLEHICTEGCTSVGPLDKEPSIKRQPCSKFDTCQGLQLLIRHFATCKRRT 258 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 K L KR+WQ+L LHASIC Sbjct: 259 KGG-CLRCKRMWQILRLHASIC 279 >ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/83 (40%), Positives = 43/83 (51%), Gaps = 21/83 (25%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG---------------------FGTCYGLQKLVHHLAICDRK 73 +Y +LS+ M+CL+HI EG F TC GLQ L+ H + C R+ Sbjct: 199 LYLQLSEGMDCLEHICREGCTSVGPYDEEYSCQKKLPCSKFDTCQGLQLLIRHFSTCKRR 258 Query: 72 KKPHFFL*FKRLWQLLHLHASIC 4 K F KR+WQLL LHASIC Sbjct: 259 VKGSCFQ-CKRMWQLLRLHASIC 280 >ref|XP_006394307.1| hypothetical protein EUTSA_v10004447mg [Eutrema salsugineum] gi|557090946|gb|ESQ31593.1| hypothetical protein EUTSA_v10004447mg [Eutrema salsugineum] Length = 366 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/88 (37%), Positives = 45/88 (51%), Gaps = 26/88 (29%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------------FGTCYGLQKLVHHLA 88 +Y +LS+AMEC++HI +EG F TCYGLQ L+ H A Sbjct: 206 LYTQLSEAMECIEHICTEGCALVGPSSNVDNNKATSQVKPGPCSAFSTCYGLQLLIRHFA 265 Query: 87 ICDRKKKPHFFL*FKRLWQLLHLHASIC 4 +C ++ L KR+ QLL LH+SIC Sbjct: 266 VCKKRVDGKGCLRCKRMIQLLRLHSSIC 293 >dbj|BAE71259.1| hypothetical protein [Trifolium pratense] Length = 553 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y ELS+AMECL+HI +EG F TC GLQ L+ H A C R+ Sbjct: 202 LYAELSEAMECLEHICTEGCTDVGPYHVEVDRERKPCSKFSTCQGLQLLIRHFATCKRRV 261 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 K + KR+WQL LH+ +C Sbjct: 262 KGGCWR-CKRMWQLFRLHSYVC 282 >ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/82 (41%), Positives = 45/82 (54%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG F TC GLQ L+ H A C +K+ Sbjct: 213 LYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFSTCQGLQLLIRHFATC-KKR 271 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 L KR+WQLL LH+S+C Sbjct: 272 VNGGCLRCKRMWQLLRLHSSMC 293 >gb|ESW09972.1| hypothetical protein PHAVU_009G170600g [Phaseolus vulgaris] Length = 324 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/83 (42%), Positives = 43/83 (51%), Gaps = 20/83 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y ELS+AM CL+HI +EG FGTC GLQ L+ H C+R K Sbjct: 184 LYTELSEAMVCLEHICTEGCTEVGPLEVEVGRGREPCSKFGTCQGLQNLIRHFVTCERVK 243 Query: 69 KPHFFL*FKRLWQLLHLHASICL 1 L KR+WQL L +SICL Sbjct: 244 GR--CLPCKRMWQLFKLDSSICL 264 >ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] gi|557542252|gb|ESR53230.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] Length = 363 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/82 (41%), Positives = 45/82 (54%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG F TC GLQ L+ H A C +K+ Sbjct: 213 LYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFATCQGLQLLIRHFATC-KKR 271 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 L KR+WQLL LH+S+C Sbjct: 272 VNGGCLRCKRMWQLLRLHSSMC 293 >ref|XP_006439989.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] gi|557542251|gb|ESR53229.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] Length = 305 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/82 (41%), Positives = 45/82 (54%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG F TC GLQ L+ H A C +K+ Sbjct: 213 LYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFATCQGLQLLIRHFATC-KKR 271 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 L KR+WQLL LH+S+C Sbjct: 272 VNGGCLRCKRMWQLLRLHSSMC 293 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Solanum lycopersicum] Length = 349 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AM+CL+HI +EG F TC GLQ L+ H A C R+ Sbjct: 199 LYLQLSEAMDCLEHICTEGCTSVGPLDKEPSIKRQPCSKFDTCQGLQFLIRHFATCKRRT 258 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 L KR+WQ+L LHASIC Sbjct: 259 NGGC-LRCKRMWQILRLHASIC 279 >ref|XP_004152501.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] gi|449503696|ref|XP_004162131.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] Length = 393 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y EL +AMECL+HI SEG + TC+GLQ L+ H A C ++ Sbjct: 227 LYLELHEAMECLEHICSEGCTIVGPSNVDPKKEREPCSHYSTCHGLQLLIKHFATCKKRT 286 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 KR+WQLL LH+SIC Sbjct: 287 NGVGCGRCKRMWQLLKLHSSIC 308 >ref|XP_004137576.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] gi|449507130|ref|XP_004162941.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] Length = 366 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 19/81 (23%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG-------------------FGTCYGLQKLVHHLAICDRKKK 67 VY +LS AMECL+HI EG + TC G+Q L+ H A C+ + Sbjct: 211 VYLQLSDAMECLEHICKEGCTNVGPLDVVPTKKQPCSKYSTCRGVQLLIKHFATCENRVH 270 Query: 66 PHFFL*FKRLWQLLHLHASIC 4 KR+WQLL LHASIC Sbjct: 271 GGACWRCKRMWQLLRLHASIC 291 >ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 365 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG FGTC GLQ L H A C R+ Sbjct: 211 LYLQLSEAMECLEHICTEGCTSVGPYDMEPGQKRGPCSKFGTCQGLQHLFQHFATCKRRV 270 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 KR+WQLL LH+S+C Sbjct: 271 NGGCSR-CKRMWQLLRLHSSMC 291 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI EG F TC GLQ L+ H A C R+ Sbjct: 263 LYLQLSEAMECLEHICKEGCTSVGPYDMEPGHNRGPCSKFSTCQGLQLLIQHFATCKRRV 322 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 L KR+WQLL LH+S+C Sbjct: 323 NGG-CLRCKRMWQLLRLHSSMC 343 >ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Glycine max] Length = 396 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y ELS+AMECL+HI EG F TC GLQ L+ H A C++K Sbjct: 244 IYAELSEAMECLEHICYEGCTHVGPYDAEVKRERTPCGRFATCQGLQVLIRHFATCEKKV 303 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 + + KR+WQL LH+ +C Sbjct: 304 RGG-CVRCKRMWQLFRLHSYVC 324 >ref|XP_002866538.1| hypothetical protein ARALYDRAFT_919604 [Arabidopsis lyrata subsp. lyrata] gi|297312373|gb|EFH42797.1| hypothetical protein ARALYDRAFT_919604 [Arabidopsis lyrata subsp. lyrata] Length = 365 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 25/87 (28%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG-------------------------FGTCYGLQKLVHHLAI 85 +Y +LS+AMEC++HI +EG F TCYGLQ L+ H A+ Sbjct: 206 LYMQLSEAMECIEHICTEGCTLVGPSSNLDDKSTSQVKTGPCSAFSTCYGLQLLIRHFAV 265 Query: 84 CDRKKKPHFFL*FKRLWQLLHLHASIC 4 C ++ + KR+ QLL LH+SIC Sbjct: 266 CKKRVDGKGCVRCKRMIQLLRLHSSIC 292 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG + TC G+Q L+ H A C R+ Sbjct: 101 LYLQLSEAMECLEHICTEGCTTVGPYDVEPAKKRGPCNKYTTCQGVQLLIKHFASCKRRA 160 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 KR+WQLL LH+SIC Sbjct: 161 NGGGCSRCKRMWQLLRLHSSIC 182 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 20/82 (24%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG--------------------FGTCYGLQKLVHHLAICDRKK 70 +Y +LS+AMECL+HI +EG + TC G+Q L+ H A C R+ Sbjct: 202 LYLQLSEAMECLEHICTEGCTTVGPYDVEPAKKRGPCNKYTTCQGVQLLIKHFASCKRRA 261 Query: 69 KPHFFL*FKRLWQLLHLHASIC 4 KR+WQLL LH+SIC Sbjct: 262 NGGGCSRCKRMWQLLRLHSSIC 283 >ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|75309213|sp|Q9FMK7.1|BT1_ARATH RecName: Full=BTB/POZ and TAZ domain-containing protein 1; AltName: Full=BTB and TAZ domain protein 1 gi|10177297|dbj|BAB10558.1| unnamed protein product [Arabidopsis thaliana] gi|36955895|gb|AAQ87004.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|38603810|gb|AAR24650.1| At5g63160 [Arabidopsis thaliana] gi|110742799|dbj|BAE99302.1| hypothetical protein [Arabidopsis thaliana] gi|332010329|gb|AED97712.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] Length = 365 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 25/87 (28%) Frame = -3 Query: 189 VYPELSKAMECLQHIFSEG-------------------------FGTCYGLQKLVHHLAI 85 +Y +LS+AMEC++HI +EG F TCYGLQ L+ H A+ Sbjct: 206 LYLQLSEAMECIEHICTEGCTLVGPSSNLDNKSTCQAKPGPCSAFSTCYGLQLLIRHFAV 265 Query: 84 CDRKKKPHFFL*FKRLWQLLHLHASIC 4 C ++ + KR+ QLL LH+SIC Sbjct: 266 CKKRVDGKGCVRCKRMIQLLRLHSSIC 292