BLASTX nr result
ID: Zingiber24_contig00017615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017615 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838398.1| hypothetical protein AMTR_s00002p00087350 [A... 61 1e-07 >ref|XP_006838398.1| hypothetical protein AMTR_s00002p00087350 [Amborella trichopoda] gi|548840904|gb|ERN00967.1| hypothetical protein AMTR_s00002p00087350 [Amborella trichopoda] Length = 376 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 95 QRHVPCLHMRPHRVGGRLVVEAVAVPSTNYLQAHRADGRL 214 +R PC+HMRPHRV GRLV+EAV VPS NYL A R +GRL Sbjct: 212 RRDGPCVHMRPHRVDGRLVLEAVPVPSHNYLHAQRGNGRL 251