BLASTX nr result
ID: Zingiber24_contig00017317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017317 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28207.1| Ribosomal protein S5 family protein [Theobroma ca... 58 1e-06 ref|XP_003542738.1| PREDICTED: 30S ribosomal protein S5, chlorop... 58 1e-06 ref|XP_003529335.1| PREDICTED: 30S ribosomal protein S5, chlorop... 57 3e-06 >gb|EOY28207.1| Ribosomal protein S5 family protein [Theobroma cacao] Length = 303 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +3 Query: 138 SHLFNTPLFSSSSSIRFHTVPKLAASPKDDIDTSFFDNVDPNSEITFDPPVPPEGY 305 S +F PL S S F ++ +A + DIDTSFFDNV+P ++ FDPP PPEG+ Sbjct: 28 SFVFPGPLKPFSLSRSFPSLSLIAHAKASDIDTSFFDNVNPEEDVVFDPPTPPEGF 83 >ref|XP_003542738.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Glycine max] Length = 316 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 12/58 (20%) Frame = +3 Query: 168 SSSSIRFHTVPK------------LAASPKDDIDTSFFDNVDPNSEITFDPPVPPEGY 305 S+SS RF +P L + P DDIDTSFFDN++P +ITF+PP PPEG+ Sbjct: 38 STSSRRFSLLPPPSHQPSKPLFLTLKSKPSDDIDTSFFDNINPQDDITFNPPEPPEGF 95 >ref|XP_003529335.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Glycine max] Length = 300 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 204 LAASPKDDIDTSFFDNVDPNSEITFDPPVPPEGY 305 L + P DDIDTSFFDN++P +ITF+PP PPEG+ Sbjct: 46 LKSKPSDDIDTSFFDNINPQDDITFNPPEPPEGF 79