BLASTX nr result
ID: Zingiber24_contig00017298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00017298 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004951464.1| PREDICTED: uncharacterized protein LOC101770... 58 1e-06 >ref|XP_004951464.1| PREDICTED: uncharacterized protein LOC101770571 [Setaria italica] Length = 171 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/88 (38%), Positives = 47/88 (53%), Gaps = 6/88 (6%) Frame = -1 Query: 315 HGSEPPGPP----HPVDAPRRRRT--WLSVFPLLYLSASAAVYGYRERGDPWSLGFVLFS 154 H + P PP HP DAP + WL+ +L ++ + +R RGD ++ FV FS Sbjct: 21 HLPQAPPPPASDGHPADAPPAGHSVRWLAAAGFAFLIFNSGMAVHRSRGDLGAIAFVAFS 80 Query: 153 YSDLLALFYCLGRFERAAEGEGTTEQRR 70 + DLLALF CL R+E A G +Q R Sbjct: 81 HLDLLALFLCLRRYEGARPGSPLRDQLR 108