BLASTX nr result
ID: Zingiber24_contig00016646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00016646 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37631.1| hypothetical protein L484_021837 [Morus notabilis] 58 1e-06 gb|EXC32467.1| hypothetical protein L484_012634 [Morus notabilis] 57 3e-06 >gb|EXB37631.1| hypothetical protein L484_021837 [Morus notabilis] Length = 559 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/103 (32%), Positives = 43/103 (41%), Gaps = 1/103 (0%) Frame = +2 Query: 53 FRRFLTYHPLNEYDFFFESIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYGFP 232 FRRFL YHP+NE++FFFESIG +GFP Sbjct: 99 FRRFLRYHPINEFEFFFESIG---IDRQDVHLFLPKKKFFLSEDSTVLDASLALIQFGFP 155 Query: 233 WTKLGLLYREEPRXXXXXXXXXXXXXXALEAR-GFHRACIIGI 358 W KLG+LYREE + R G+ C++G+ Sbjct: 156 WNKLGVLYREEVSIFSMSGDELTDRLNGFKERFGYDHLCVVGV 198 >gb|EXC32467.1| hypothetical protein L484_012634 [Morus notabilis] Length = 563 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/103 (32%), Positives = 42/103 (40%), Gaps = 1/103 (0%) Frame = +2 Query: 53 FRRFLTYHPLNEYDFFFESIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYGFP 232 F+RFL YHP+NE++FF ESIG +GFP Sbjct: 99 FKRFLRYHPINEFEFFLESIG---IHRDDVHLFLPKKKFFFSEDSTVLDASLALIQFGFP 155 Query: 233 WTKLGLLYREEPRXXXXXXXXXXXXXXALEAR-GFHRACIIGI 358 W KLGLLYREE + R GF C++G+ Sbjct: 156 WNKLGLLYREEVSIFSMSGNVLTDRLNGFKERFGFDNLCVVGV 198