BLASTX nr result
ID: Zingiber24_contig00016343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00016343 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840956.1| hypothetical protein AMTR_s00085p00019560 [A... 58 1e-06 >ref|XP_006840956.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda] gi|548842848|gb|ERN02631.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda] Length = 395 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = +3 Query: 3 WDQRSFASXXXXXXXXXXXXXXXXYVNQTRRIEELFGKIWPPPNV 137 WDQ SFAS YVNQTRR+EELFGKIWPPPNV Sbjct: 351 WDQLSFASAMGPAAEELLGVGLEGYVNQTRRVEELFGKIWPPPNV 395